Tested Applications
| Positive WB detected in | MCF-7 cells, human placenta, mouse testis tissue, rat spleen tissue |
| Positive IF/ICC detected in | MCF-7 cells, A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27126-1-AP targets CCDC90B in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25934 Product name: Recombinant human CCDC90B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 146-246 aa of BC014573 Sequence: IELDQVKQQLMHETSRIRADNKLDINLERSRVTDMFTDQEKQLMETTTEFTKKDTQTKSIISETSNKIDAEIASLKTLMESNKLETIRYLAASVFTCLAIA Predict reactive species |
| Full Name | coiled-coil domain containing 90B |
| Observed Molecular Weight | 28 kDa |
| GenBank Accession Number | BC014573 |
| Gene Symbol | CCDC90B |
| Gene ID (NCBI) | 60492 |
| RRID | AB_3669584 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9GZT6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CCDC90B (Coiled-coil domain-containing protein 90B) is predicted to have a single-pass transmembrane domain located at its C-terminal. As two isoforms belong to the same protein family, CCDC90A/MCUR1 and CCDC90B show similar expression levels among tissues with few exceptions.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CCDC90B antibody 27126-1-AP | Download protocol |
| WB protocol for CCDC90B antibody 27126-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CCDC90B Polyclonal antibody (Cat# 27126-1-AP) has 1 citation to date. The publication appeared in Stem Cell Reports (IF 5.6), published in 2026. The study, "Targeting CCDC90B restores intestinal stem cell function under hyperuricemic stress," belongs to the research fields of stem cell biology and intestinal physiology under metabolic stress conditions.
| Species | Application | Title |
|---|---|---|
Stem Cell Reports Targeting CCDC90B restores intestinal stem cell function under hyperuricemic stress. |
