Tested Applications
| Positive IHC detected in | mouse pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28102-1-AP targets SLC38A5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27881 Product name: Recombinant human SLC38A5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-48 aa of BC019246 Sequence: MELQDPKMNGALPSDAVGYRQEREGFLPSRGPAPGSKPVQFMDFEGKT Predict reactive species |
| Full Name | solute carrier family 38, member 5 |
| Calculated Molecular Weight | 472 aa, 51 kDa |
| Observed Molecular Weight | 45 kDa |
| GenBank Accession Number | BC019246 |
| Gene Symbol | SLC38A5 |
| Gene ID (NCBI) | 92745 |
| RRID | AB_2881061 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8WUX1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SLC38A5 antibody 28102-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SLC38A5 Polyclonal antibody (Cat# 28102-1-AP) has 3 total citations. These appear in Cell Death & Disease, NPJ Biofilms and Microbiomes, and Frontiers in Cell and Developmental Biology. The associated research fields include colorectal cancer stem cell biology and drug resistance, gut microbiome-mediated metabolic regulation, and osteosarcoma hypoxia-immune microenvironment. All citations used the antibody for Western Blot in human samples.
| Species | Application | Title |
|---|---|---|
Cell Death Dis Loss of cadherin 17 downregulates LGR5 expression, stem cell properties and drug resistance in metastatic colorectal cancer cells.
| ||
NPJ Biofilms Microbiomes Gut-resident Phascolarctobacterium succinatutens decreases fat accumulation via MYC-driven epigenetic regulation of arginine biosynthesis | ||
Front Cell Dev Biol Hypoxia-immune-related microenvironment prognostic signature for osteosarcoma |
