Tested Applications
| Positive WB detected in | THP-1 cells, RAW 264.7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28138-1-AP targets TYROBP/DAP12 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27252 Product name: Recombinant human TYROBP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-113 aa of BC011175 Sequence: MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK Predict reactive species |
| Full Name | TYRO protein tyrosine kinase binding protein |
| Calculated Molecular Weight | 12 kDa |
| Observed Molecular Weight | 10-12 kDa |
| GenBank Accession Number | BC011175 |
| Gene Symbol | TYROBP |
| Gene ID (NCBI) | 7305 |
| RRID | AB_3669646 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O43914 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TYROBP, also known as DAP12 or KARAP, is a transmembrane protein consisting of a very small extracellular region, a transmembrane domain containing an aspartic acid residue critical for association with its partner subunits, and an intracellular domain with a single immunoreceptor tyrosine-based activation motif (ITAM) (PMID: 11114420). It is expressed as a disulfide-bonded homodimer on natural killer cells, myeloid cells and a subset of T cells (PMID: 11114420). TYROBP acts as a signaling adaptor that provides signaling function via the Syk and ZAP-70 tyrosine kinase activation pathways (PMID: 15895090). The gene of TYROBP is located on the long arm of chromosome 19 at position 13.1. Multiple alternative transcript variants encoding distinct isoforms have been identified for this gene.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for TYROBP/DAP12 antibody 28138-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TYROBP/DAP12 polyclonal antibody (catalog number 28138-1-AP) has 2 total citations. Both appear in peer-reviewed journals: Phytomedicine and the Journal of Ethnopharmacology. The research fields span neurodegenerative disease (Alzheimer's disease, involving microglial polarization via TYROBP activation by berberine) and oncology/immunology (hepatocellular carcinoma, where the TREM1/DAP12 pathway modulates the immunosuppressive tumor microenvironment and PD-1 inhibitor efficacy). Both studies used the antibody for Western blot in mouse models.
| Species | Application | Title |
|---|---|---|
Phytomedicine Berberine modulates microglial polarization by activating TYROBP in Alzheimer's disease | ||
J Ethnopharmacol Jianpi-huayu Decotion regulates TREM1/DAP12 pathway to improve the immunosuppressive tumor microenvironment and enhance the anti-hepatocellular carcinoma effect of PD-1 inhibitors. |
Reviews
What customers say
The single review for this DAP12 antibody (used at 1:500 dilution for Western Blot) reports mixed results. The antibody performed well on mouse brain homogenate, producing a clear signal. However, it failed to yield a detectable signal in mouse primary cell homogenate, which the reviewer attributed to potentially lower protein loading. The reviewer noted that a different DAP12 antibody successfully detected the target under the same conditions. Overall, the reviewer rated the product 3 out of 5, suggesting it works reliably in tissue homogenates but may require optimization for cell-based samples.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Katia (Verified Customer) (09-09-2025) | The antibody performed well on mouse brain homogenate. However, it did not yield a signal in primary cells homogenate, possibly due to lower protein loading. Notably, a different DAP12 antibody worked under the same conditions.
|
