Use Able AI chat for product recommendations

GDF9 Polyclonal antibody

GDF9 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 29309-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

GDF 9, GDF-9

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, A2780 cells, fetal human brain tissue, SKOV-3 cells, mouse ovary tissue, rat ovary tissue, mouse testis tissue, rat brain tissue, rat testis tissue
Positive IP detected inA2780 cells
Positive IHC detected inmouse ovary tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inSKOV-3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

29309-1-AP targets GDF9 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivitymouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag29603

Product name: Recombinant human GDF9 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 400-454 aa of BC096228

Sequence: TMVQNIIYEKLDSSVPRPSCVPAKYSPLSVLTIEPDGSIAYKEYEDMIATKCTCR

Predict reactive species
Full Name growth differentiation factor 9
Calculated Molecular Weight 454 aa, 51 kDa
Observed Molecular Weight 70 kDa
GenBank Accession NumberBC096228
Gene Symbol GDF9
Gene ID (NCBI) 2661
RRIDAB_3086112
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO60383
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GDF9 (Growth/differentiation factor 9) belongs to the TGF-beta family. GDF9 is required for ovarian folliculogenesis. GDF9 and BMP15 are oocyte-secreted factors with a leading role in the control of ovarian function in female reproduction, modulating both the cell fate of the somatic granulosa cells and the quality and developmental competence of the egg (PMID: 29544636). GDF9 promotes cell transition from G0/G1 to S and G2/M phases, through an increase of CCND1 and CCNE1 expression, and RB1 phosphorylation (PMID: 19366876). It regulates STAR expression and cAMP-dependent progesterone release in granulosa and thecal cells. GDF9 attenuates the suppressive effects of activin A on STAR expression and progesterone production by increasing the expression of inhibin B (PMID: 21829661). It suppresses FST and FSTL3 production in granulosa-lutein cells  (PMID: 21632818, PMID: 21829661).

Protocols

Product Specific Protocols
IF protocol for GDF9 antibody 29309-1-APDownload protocol
IHC protocol for GDF9 antibody 29309-1-APDownload protocol
IP protocol for GDF9 antibody 29309-1-APDownload protocol
WB protocol for GDF9 antibody 29309-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouseWB,IHC

Biomedicines

Ferulic Acid Alleviates Chemotherapy-Induced POI by Targeting the Grp78 and Perk-eIF2α-ATF4-CHOP Pathway to Attenuate Endoplasmic Reticulum Stress.

Authors - Fan Li
ratWB

J Ovarian Res

Yangjingzhongyu Decoction regulates primordial follicle initiation via LncRNA-Smad1/AMPK dual pathways in diminished ovarian reserve.

Authors - Wanjing Li
ratIF

J Sci Food Agric

Therapeutic mechanism of Polygonum multiflorum Thunb. in premature ovarian insufficiency: an integration of network pharmacology, molecular docking, and experimental validation.

Authors - Jinhong Li
mouseIF

Apoptosis

CCDC134 enhances ovarian reserve function and angiogenesis by directly interacting with INHA in a mouse model of premature ovarian insufficiency

Authors - Xiangrong Cui
mouseWB

J Pharmacol Sci

Specnuezhenide and ecliptasaponin A from Ligustrum lucidum Ait and Ecliptae Herba improved premature ovarian failure by targeting the ESR1

Authors - Jia Xu

Oncogene

HDAC1/2-mediated deacetylation of KLF9 promotes the malignant progression of nasopharyngeal carcinoma via CDH17

Authors - Kun Zhang

Reviews

    5.0 out of 5
Add a review

2 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


MALLIKARJUNA (Verified Customer) (10-24-2025)

best for western blot

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: liver tissue

Yiran (Verified Customer) (09-19-2024)

Works well on paraffin-fixed sheep ovary for immunofluorescent

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Ovary
GDF9 Antibody Immunohistochemistry validation (1:100 dilution) in Ovary (Cat no:29309-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...