Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat brain tissue, mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
29588-1-AP targets Glutamate receptor 3/GluA3 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30898 Product name: Recombinant human GRIA3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 288-425 aa of NM_007325 Sequence: VRLDEREFPEAKNAPLKYTSALTHDAILVIAEAFRYLRRQRVDVSRRGSAGDCLANPAVPWSQGIDIERALKMVQVQGMTGNIQFDTYGRRTNYTIDVYEMKVSGSRKAGYWNEYERFVPFSDQQISNDSASSENRTI Predict reactive species |
| Full Name | glutamate receptor, ionotrophic, AMPA 3 |
| Calculated Molecular Weight | 101 kDa |
| Observed Molecular Weight | 101 kDa |
| GenBank Accession Number | NM_007325 |
| Gene Symbol | GRIA3 |
| Gene ID (NCBI) | 2892 |
| RRID | AB_3086141 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P42263 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. GRIA3 (Glutamate ionotropic receptor AMPA type subunit 3), also known as Glutamate receptor R3 or A3 (GluR3 or GluA3), is associated with X-linked intellectual disability (ID), dysmorphic features, and non-syndromic epilepsy(PMID: 32977175). GRIA3 also plays a role as a mediator of tumor progression in pancreatic cancer downstream CUX1(PMID: 20689760).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Glutamate receptor 3/GluA3 antibody 29588-1-AP | Download protocol |
| IHC protocol for Glutamate receptor 3/GluA3 antibody 29588-1-AP | Download protocol |
| IP protocol for Glutamate receptor 3/GluA3 antibody 29588-1-AP | Download protocol |
| WB protocol for Glutamate receptor 3/GluA3 antibody 29588-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Glutamate receptor 3/GluA3 Polyclonal antibody (Cat# 29588-1-AP) has 7 citations published in Cell Discov, Advanced Science, Molecular Psychiatry, iScience, Journal of Neuroscience, Brain Research, and Frontiers in Cardiovascular Medicine. Research fields span neural ensemble remodeling in social competition, stress-induced anxiety via glutamatergic circuits, Alzheimer's disease (synaptic dysfunction and astrocyte-microglia interaction), ALS-FTD network dysfunction, AMPA receptor-mediated cognitive function, and glutamatergic signaling in cardiac fibrosis. Applications include WB and IHC in mouse and rat models.
| Species | Application | Title |
|---|---|---|
Cell Discov Postsynaptic lncRNA Sera/Pkm2 pathway orchestrates the transition from social competition to rank by remodeling the neural ensemble in mPFC | ||
Adv Sci (Weinh) An Anterior Cingulate Cortex-Anterior Insular Cortex Glutamatergic Circuit Gates Stress-Induced Visceral Hypersensitivity and Anxiety via Ionotropic Glutamate Receptors Trafficking. | ||
Mol Psychiatry The dynamic impairment of synaptic transmission in the PCx-IL engram circuit contributes to early olfactory memory decline in Alzheimer's disease. | ||
iScience The decreased astrocyte-microglia interaction reflects the early characteristics of Alzheimer's disease | ||
J Neurosci Network Dysfunction Precedes Neurodegeneration in a dox-Regulatable TDP-43 Mouse Model of ALS-FTD. | ||
Brain Res Low-dose diazepam improves cognitive function in APP/PS1 mouse models: Involvement of AMPA receptors |
Reviews
What customers say
The single review for this product is a 5-star rating from a Western Blot application. The user reported that the antibody works well on cerebellum lysates at a 1:2000 dilution, confirming reliable performance for WB detection in cerebellum tissue.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Andrea (Verified Customer) (08-05-2026) | It works by WB on cerebellum lysates
|
