Tested Applications
| Positive WB detected in | pig bone marrow tissue |
| Positive IHC detected in | human hepatocirrhosis tissue, human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
29755-1-AP targets Eosinophil peroxidase in WB, IHC, ELISA applications and shows reactivity with human, mouse, pig samples.
| Tested Reactivity | human, mouse, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30561 Product name: Recombinant human EPX protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 580-673 aa of NM_000502 Sequence: LSQPRNLAQLSRVLKNQDLARKFLNLYGTPDNIDIWIGAIAEPLLPGARVGPLLACLFENQFRRARDGDRFWWQKRGVFTKRQRKALSRISLSR Predict reactive species |
| Full Name | eosinophil peroxidase |
| Calculated Molecular Weight | 81 kDa |
| Observed Molecular Weight | 55 kDa |
| GenBank Accession Number | NM_000502 |
| Gene Symbol | EPX |
| Gene ID (NCBI) | 8288 |
| RRID | AB_3086154 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P11678 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Eosinophil peroxidase antibody 29755-1-AP | Download protocol |
| WB protocol for Eosinophil peroxidase antibody 29755-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Eosinophil peroxidase (EPX) polyclonal antibody (Cat# 29755-1-AP) has 2 citations. One appears in Allergy, studying mepolizumab's effects on blood eosinophil proteome and transcriptome in severe eosinophilic asthma. The other is in J Nanobiotechnology, investigating eosinophil-derived apoptotic extracellular vesicles accelerating steatotic liver repair after ischemia/reperfusion injury. The associated research fields span immunology/allergy and liver disease/nanotechnology.
| Species | Application | Title |
|---|---|---|
J Nanobiotechnology Eosinophil-derived apoptotic extracellular vesicles accelerate steatotic liver repair after ischemia/reperfusion injury through mitochondria-associated metabolic reprogramming. | ||
Allergy Mepolizumab Modifies Blood Eosinophil Proteome and Transcriptome in Severe Eosinophilic Asthma. |
Reviews
What customers say
One reviewer rated this antibody 4/5 for immunofluorescence on mouse lung tissue at a 1:700 dilution. They noted that permeabilization with Triton was required, and used Tris-EDTA buffer (pH 9.0) for antigen retrieval. The secondary antibody was Goat anti-rabbit IgG AlexaFluor 555 at 1:500, with DAPI Fluoromount-G mounting medium. Overall, the antibody performed well under these optimized conditions.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Adélaïde (Verified Customer) (05-14-2025) | - Need to permeabilize (Triton) - Secondary antibody Goat anti-rabbit IgG AlexaFluor555 antibody (Life Technologies, Ref no: A21428) (1:500) - DAPI Fluromount-G (SouthernBiotech, Ref no: 0100-20) - Antigen retrieval : Tris-EDTA buffer (10 mM Tris base, 1 mM EDTA solution, 0.05% Tween 20, pH 9.0)
 |
