Use Able AI chat for product recommendations

Integrin beta-8 Polyclonal antibody

Integrin beta-8 Polyclonal Antibody for WB, IHC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

ITGB8, Integrin beta 8, integrin, beta 8

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for Integrin beta-8 in ?

Tested Applications

Positive WB detected inmouse brain tissue, rat brain tissue
Positive IHC detected inhuman ovary cancer tissue, human intrahepatic cholangiocarcinoma tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

29775-1-AP targets Integrin beta-8 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag31137

Product name: Recombinant human Integrin beta-8 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 460-620 aa of NM_002214

Sequence: KIHIHRNCSCQCEDNRGPKGKCVDETFLDSKCFQCDENKCHFDEDQFSSESCKSHKDQPVCSGRGVCVCGKCSCHKIKLGKVYGKYCEKDDFSCPYHHGNLCAGHGECEAGRCQCFSGWEGDRCQCPSAAAQHCVNSKGQVCSGRGTCVCGRCECTDPRSI

Predict reactive species
Full Name integrin, beta 8
Calculated Molecular Weight 86 kDa
Observed Molecular Weight95 kDa
GenBank Accession NumberNM_002214
Gene Symbol Integrin beta 8
Gene ID (NCBI) 3696
RRIDAB_2935479
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP26012
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Integrins are cell adhesion receptors that are heterodimers composed of non-covalently associated alpha and beta subunits. Integrin beta-8 (ITGB8), belongs to the integrin beta chain family, contains an N-terminal signal peptide, a large extracellular domain that includes four cysteine-rich repeats, a transmembrane domain, and a C-terminal cytoplasmic domain (PMID: 1918072). Integrin beta-8 associates with integrin alpha-V (ITGAV) to form an αvβ8 heterodimer which has been shown to bind vitronectin, fibronectin, and a latency-associated peptide of TGF-β1/3 (PMID: 27033701). Integrin beta-8 contains multiple potential N-linked glycosylation sites. The observed molecular mass of approximately 95 kDa for integrin beta-8 is larger than the predicted 86 kDa, consistent with substantial glycosylation (PMID: 1918072).

Protocols

Product Specific Protocols
IHC protocol for Integrin beta-8 antibody 29775-1-APDownload protocol
WB protocol for Integrin beta-8 antibody 29775-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Integrin beta-8 Polyclonal antibody (Cat# 29775-1-AP) has 4 total citations. These appear in Nature Communications, Experimental & Molecular Medicine, Science Advances, and Medicine (Baltimore). The cited research spans immunology (oral tolerance via innate sensing pathways), bone biology (osteoclastogenesis and mitochondrial respiration), and oncology (colorectal cancer metastasis and hepatocellular carcinoma).

SpeciesApplicationTitle

Nat Commun

Dietary nucleic acids promote oral tolerance through innate sensing pathways in mice

Authors - Tao Yang
mouse,humanWB

Exp Mol Med

Osteoblast-derived osteomodulin restrains osteoclastogenesis via ITGB8/RRM2-mediated reduction of mitochondrial respiration and mitochondrial ATP production.

Authors - Xiaowen Jiang
IHC

Sci Adv

AKR1B10 dictates c-Myc stability to suppress colorectal cancer metastasis via PP2A nitration

Authors - Xiaoxue Wu
humanIHC

Medicine (Baltimore)

Prognostic value and potential molecular mechanism of ITGB superfamily members in hepatocellular carcinoma

Authors - Haixiang Xie
Loading...
||
New chat

Able™

正在加载,请稍候...