CDK10 Polyclonal antibody

CDK10 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 30061-1-AP

Publications(1)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

Serine/threonine-protein kinase PISSLRE, EC:2.7.11.22, Cyclin-dependent kinase 10, Cyclin dependent kinase 10

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIF/ICC

WB analysis using 30061-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 30061-1-AP (CDK10 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of hTERT-RPE1 using 30061-1-AP
Immunofluorescent analysis of (4% PFA) fixed hTERT-RPE1 cells using CDK10 antibody (30061-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CoraLite®594 ARL13B antibody (CL594-17711, red).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Publications (1)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	A431 cells, K-562 cells, THP-1 cells, U2OS cells, C2C12 cells
Positive IF/ICC detected in	hTERT-RPE1 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:3000
Immunofluorescence (IF)/ICC	IF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

30061-1-AP targets CDK10 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Cited Reactivity	mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag30365 Product name: Recombinant human CDK10 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 190-283 aa of BC017342 Sequence: NIWPGFSKLPLVGQYSLRKQPYNNLKHKFPWLSEAGLRLLHFLFMATAGDCLESSYFKEKPLPCEPELMPTFPHHRNKRAAPATSEGQSKRCKP Predict reactive species
Full Name	cyclin-dependent kinase 10
Calculated Molecular Weight	283 aa, 32 kDa
Observed Molecular Weight	38 kDa
GenBank Accession Number	BC017342
Gene Symbol	CDK10
Gene ID (NCBI)	8558
RRID	AB_2935507
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q15131
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cyclin-dependent kinase 10 (CDK10) is a Cdc2-related kinase that was discovered based on its homology to the Cdc2 PSTA1RE amino acid domain (PMID: 8208557). CDK10 plays a pivotal role in the regulation of fundamental cellular processes, including cell proliferation, transcription regulation, and cell cycle regulation. It partners with cyclin M to phosphorylate substrates such as ETS2 and PKN2 in order to modulate cellular growth. Initial reports have indicated that CDK10 may act as a tumor suppressor in breast cancer (PMID: 26392360). Additional studies have demonstrated tumor suppressive and oncogenic roles for CDK10 in malignancies such as hepatobiliary cancers, gastric cancer, glioma, nasopharyngeal carcinoma, and colorectal cancer(PMID: 22326270, PMID: 29512714, PMID: 23740091, PMID: 29845196)