SEC23A Polyclonal antibody

SEC23A Polyclonal Antibody for WB, IP, ELISA

Cat No. 30465-1-AP

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

CLSD, SEC23 related protein A

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

Freight/Packing: -

Quantity

- +

Filter: AllWBIP

WB analysis using 30465-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 30465-1-AP (SEC23A antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of NIH/3T3 using 30465-1-AP
IP result of anti-SEC23A (IP:30465-1-AP, 4ug; Detection:30465-1-AP 1:1500) with NIH/3T3 cells lysate 1200 ug.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SEC23A in ?

Positive WB detected in	COS-7 cells, NIH/3T3 cells, PC-12 cells
Positive IP detected in	NIH/3T3 cells

Application	Dilution
Western Blot (WB)	WB : 1:500-1:3000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

30465-1-AP targets SEC23A in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag33185 Product name: Recombinant human SEC23A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 660-765 aa of BC036649 Sequence: HGETIAQWRKSGYQDMPEYENFRHLLQAPVDDAQEILHSRFPMPRYIDTEHGGSQARFLLSKVNPSQTHNNMYAWGQESGAPILTDDVSLQVFMDHLKKLAVSSAA Predict reactive species
Full Name	Sec23 homolog A (S. cerevisiae)
Calculated Molecular Weight	86 kDa
Observed Molecular Weight	86 kDa
GenBank Accession Number	BC036649
Gene Symbol	SEC23A
Gene ID (NCBI)	10484
RRID	AB_3742345
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q15436
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.