Tested Applications
| Positive WB detected in | HL-60 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
30868-1-AP targets MPC1 in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28826 Product name: Recombinant human BRP44L protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-109 aa of BC000810 Sequence: MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCCYSLTFMRFAYKVQPRNWLLFACHATNEVAQLIQGGRLIKHEMTKTASA Predict reactive species |
| Full Name | brain protein 44-like |
| Calculated Molecular Weight | 12 kDa |
| Observed Molecular Weight | 12 kDa, 20-24 kDa |
| GenBank Accession Number | BC000810 |
| Gene Symbol | BRP44L |
| Gene ID (NCBI) | 51660 |
| RRID | AB_3742379 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y5U8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MPC1, also known as BRP44L. BRP44L is predicted to be located in Mitochondrion inner membrane. The protein forms a heterodimer with MPC2, and the heterodimer is a more stable and dominant form (PMID:26253029, PMID:32403431). Mpc1 and Mpc2 associate to form an ~150-kilodalton complex in the inner mitochondrial membrane. Yeast and Drosophila mutants lacking MPC1 display impaired pyruvate metabolism, with an accumulation of upstream metabolites and a depletion of tricarboxylic acid cycle intermediates. Loss of yeast Mpc1 results in defective mitochondrial pyruvate uptake, and silencing of MPC1 or MPC2 in mammalian cells impairs pyruvate oxidation. A point mutation in MPC1 provides resistance to a known inhibitor of the mitochondrial pyruvate carrier (PMID: 22628558).The molecular weight of MPC1 is 12 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for MPC1 antibody 30868-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The antibody 30868-1-AP (anti-MPC1) has 1 total citation. It appears in Frontiers in Pediatrics (IF 2.2), a 2026 study investigating how MPC1 promotes damage to human coronary endothelial cells in macrolide-resistant Mycoplasma pneumoniae infection by inhibiting mitophagy. The research field spans infectious disease and mitochondrial biology (mitophagy). The application used was Western blot (WB) in human samples.
| Species | Application | Title |
|---|---|---|
Front Pediatr MPC1 promotes the damage of human coronary endothelial cells in macrolide-resistant mycoplasma pneumoniae via inhibiting mitophagy. |
