Tested Applications
| Positive WB detected in | EC109 cells, K-562 cells, mouse testis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
31205-1-AP targets CLK4 in WB, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag34446 Product name: Recombinant human CLK4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 10-130 aa of NM_020666 Sequence: PDWDSRESWGHESYRGSHKRKRRSHSSTQENRHCKPHHQFKESDCHYLEARSLNERDYRDRRYVDEYRNDYCEGYVPRHYHRDIESGYRIHCSKSSVRSRRSSPKRKRNRHCSSHQSRSKS Predict reactive species |
| Full Name | CDC-like kinase 4 |
| Calculated Molecular Weight | 57 kDa |
| Observed Molecular Weight | 55 kDa |
| GenBank Accession Number | NM_020666 |
| Gene Symbol | CLK4 |
| Gene ID (NCBI) | 57396 |
| RRID | AB_3669900 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q9HAZ1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CDC-like kinase 4 (CLK4) is a dual-specificity kinase that can phosphorylate the tyrosine or serine/threonine residues of substrates. CLK4 belongs to the LAMMER kinase family, which includes three other characterised isoforms: CLK1-3. CLK2 and CLK4 are essential regulators of DNA damage-induced IKK and NF-κB activity (PMID: 37506701).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for CLK4 antibody 31205-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CLK4 polyclonal antibody (catalog #31205-1-AP) has 1 total citation. This citation appears in Science Advances (IF 13.9), published in November 2025. The study investigated the regulatory landscape and functional diversity of RNA polymerase II CTD phosphorylation, placing the research in the field of transcription regulation and kinase signaling. The antibody was applied in Western Blot using human samples.
| Species | Application | Title |
|---|---|---|
Sci Adv FeaSion decodes the regulatory landscape and functional diversity of RNA polymerase II CTD phosphorylation.
|
