Tested Applications
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
51092-1-AP targets ADORA2A in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0470 Product name: Recombinant human ADORA2A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 300-412 aa of BC013780 Sequence: RKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS Predict reactive species |
| Full Name | adenosine A2a receptor |
| Calculated Molecular Weight | 412 aa, 45 kDa |
| Observed Molecular Weight | 38 kDa, 40-45 kDa |
| GenBank Accession Number | BC013780 |
| Gene Symbol | ADORA2A |
| Gene ID (NCBI) | 135 |
| RRID | AB_2881245 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P29274 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Adenosine (ADO) is a retaliatory metabolite that is expressed in conditions of injury or stress. Its physiological functions are mediated through interaction with four specific transmembrane receptors called ADORA1, ADORA2A, ADORA2B, and ADORA3 (PMID:23994158). ADORA2A (adenosine A2A receptor) has been shown to dampen inflammatory responses. ADORA2A signaling has been discovered on polymorphonuclear neutrophils (PMNs) (PMID:36009485).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ADORA2A antibody 51092-1-AP | Download protocol |
| WB protocol for ADORA2A antibody 51092-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-ADORA2A antibody (Cat# 51092-1-AP) has 10 total citations spanning journals including Science Bulletin, Advanced Science, Phytomedicine, Journal of Pharmaceutical Analysis, Molecular Neurobiology, Inflammation, Journal of Sexual Medicine, Pediatric Research, Frontiers in Pediatrics, and Ophthalmic Research. Research fields cover immunology/inflammation, neuroscience, liver ischemia-reperfusion, acute lung injury, depression, smooth muscle physiology, neonatal brain injury, genetics, and ophthalmology. Applications include WB and IHC across mouse, rat, and human species.
| Species | Application | Title |
|---|---|---|
Sci Bull (Beijing) Purinergic signaling by TCRαβ+ double-negative T regulatory cells ameliorates liver ischemia-reperfusion injury | ||
Adv Sci (Weinh) Targeting the Negative Feedback of Adenosine-A2AR Metabolic Pathway by a Tailored Nanoinhibitor for Photothermal Immunotherapy. | ||
Phytomedicine Celastrol Ameliorates Systemic Lupus Erythematosus via Restoring Nt5e/ adenosine-dependent Th17/Treg Balance. | ||
J Pharm Anal Inosine: a broad-spectrum anti-inflammatory against SARS-CoV-2 infection-induced acute lung injury via suppressing TBK1 phosphorylation | ||
Mol Neurobiol Ketamine counteracts sevoflurane-induced depressive-like behavior and synaptic plasticity impairments through the adenosine A2A receptor/ERK pathway in rats | ||
Inflammation GBP5 Aggravates Acute Lung Injury Via NLRP3 Inflammasome Activation While Inducing a HIF-1α-CD73-adenosine Feedback Loop. |
