CD7 Monoclonal antibody

CD7 Monoclonal Antibody for WB, IHC, IHC-Autostainer, ELISA

Cat No. 60209-2-Ig

Clone No. 2A4E6

Review Product

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, IHC-Autostainer, ELISA

Synonyms

2A4E6, CD7 molecule, GP40, LEU-9, T cell antigen CD7

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHC-AutostainerIHC

WB analysis of Jurkat using 60209-2-Ig
Untreated and PNGase F-treated lysates of Jurkat cells were subjected to SDS PAGE followed by western blot with 60209-2-Ig (CD7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. PNGase F was obtained from Atagenix (cat.NO. ata808).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 60209-2-Ig
Various lysates were subjected to SDS PAGE followed by western blot with 60209-2-Ig (CD7 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human appendicitis using 60209-2-Ig
Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 60209-2-Ig (CD7 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human large intestine using 60209-2-Ig
Immunohistochemical analysis of paraffin-embedded human large intestine tissue slide using 60209-2-Ig (CD7 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lymphoma using 60209-2-Ig
Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 60209-2-Ig (CD7 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human tonsillitis using 60209-2-Ig
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 60209-2-Ig (CD7 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human tonsillitis using 60209-2-Ig
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 60209-2-Ig (CD7 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human tonsillitis using 60209-2-Ig
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 60209-2-Ig (CD7 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human appendicitis using 60209-2-Ig
Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 60209-2-Ig (CD7 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human appendicitis using 60209-2-Ig
Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 60209-2-Ig (CD7 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human tonsillitis using 60209-2-Ig
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 60209-2-Ig (CD7 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human tonsillitis using 60209-2-Ig
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 60209-2-Ig (CD7 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human appendicitis using 60209-2-Ig
Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 60209-2-Ig (CD7 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lymphoma using 60209-2-Ig
Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 60209-2-Ig (CD7 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human large intestine using 60209-2-Ig
Immunohistochemical analysis of paraffin-embedded human large intestine tissue slide using 60209-2-Ig (CD7 antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human appendicitis using 60209-2-Ig
Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 60209-2-Ig (CD7 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lymphoma using 60209-2-Ig
Immunohistochemical analysis of paraffin-embedded human lymphoma tissue slide using 60209-2-Ig (CD7 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lymphoma using 60209-2-Ig
Immunohistochemical analysis of paraffin-embedded human lymphoma using 60209-2-Ig(CD7 antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lymphoma using 60209-2-Ig
Immunohistochemical analysis of paraffin-embedded human lymphoma using 60209-2-Ig(CD7 antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse thymus using 60209-2-Ig
Immunohistochemical analysis of paraffin-embedded mouse thymus tissue slide using 60209-2-Ig (CD7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse thymus using 60209-2-Ig
Immunohistochemical analysis of paraffin-embedded mouse thymus tissue slide using 60209-2-Ig (CD7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CD7 in ?

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	Jurkat cells, HepG2 cells, HuH-7 cells, MOLT-4 cells
Positive IHC-Autostainer detected in	human lymphoma tissue, human tonsillitis tissue, human large intestine tissue, human appendicitis tissue
Positive IHC detected in	human tonsillitis tissue, human large intestine tissue, human lymphoma tissue, human tonsillitis tissue, human appendicitis tissue, mouse thymus tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:4000
Immunohistochemistry (IHC)-AUTOSTAINER	IHC-AUTOSTAINER : 1:1000-1:4000
Immunohistochemistry (IHC)	IHC : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60209-2-Ig targets CD7 in WB, IHC, IHC-Autostainer, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag1805 Product name: Recombinant human CD7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-240 aa of BC009293 Sequence: MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPAALAVISFLLGLGLGVACVLARTQIKKLCSWRDKNSAACVVYEDMSHSRCNTLSSPNQYQ Predict reactive species
Full Name	CD7 molecule
Calculated Molecular Weight	240 aa, 25 kDa
Observed Molecular Weight	34-36 kDa
GenBank Accession Number	BC009293
Gene Symbol	CD7
Gene ID (NCBI)	924
ENSEMBL Gene ID	ENSG00000173762
RRID	AB_2881355
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein G purification
UNIPROT ID	P09564
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD7, also known as Leu-9 or GP40, is a 40-kDa single-pass type I transmembrane glycoprotein belonging to the immunoglobulin superfamily. CD7 is expressed on thymocytes, T cells, NK cells, and cells in the early stages of T, B, and myeloid cell differentiation (PMID: 10530432). It is one of the earliest antigens to appear on cells of the T-lymphocyte lineage (PMID: 3501369). CD7 plays a significant role in T-cell and T-cell/B-cell interactions during early lymphoid development. It is involved in the regulation of cell signaling and biology, including T-cell activation, proliferation, and the expression of interleukin-2 receptor alpha (IL-2Rα) (PMID: 11485208). CD7 is not only a marker for T-cells but also has functional implications in immune cell interactions and adhesion. It can provide co-stimulatory signals and is associated with CD3 and CD45, participating in T-cell activation (PMID: 7523512).