Tested Applications
| Positive WB detected in | HEK-293 cells, Raji cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
60239-1-Ig targets Desmocollin 2 in WB, IF, ELISA, Blocking assay applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5450 Product name: Recombinant human DSC2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 25-357 aa of BC063291 Sequence: LIFASDACKNVTLHVPSKLDAEKLVGRVNLKECFTAANLIHSSDPDFQILEDGSVYTTNTILLSSEKRSFTILLSNTENQEKKKIFVFLEHQTKVLKKRHTKEKVLRRAKRRWAPIPCSMLENSLGPFPLFLQQVQSDTAQNYTIYYSIRGPGVDQEPRNLFYVERDTGNLYCTRPVDREQYESFEIIAFATTPDGYTPELPLPLIIKIEDENDNYPIFTEETYTFTIFENCRVGTTVGQVCATDKDEPDTMHTRLKYSIIGQVPPSPTLFSMHPTTGVITTTSSQLDRELIDKYQLKIKVQDMDGQYFGLQTTSTCIINIDDVNDHLPTFTR Predict reactive species |
| Full Name | desmocollin 2 |
| Calculated Molecular Weight | 100 kDa |
| Observed Molecular Weight | 110 kDa |
| GenBank Accession Number | BC063291 |
| Gene Symbol | Desmocollin 2 |
| Gene ID (NCBI) | 1824 |
| RRID | AB_2881362 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q02487 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Desmocollin 2 (DSC2) is a member of the desmocollin subfamily of the cadherin superfamily. The desmocollins (DSC1-3), along with the desmogleins (DSG1-4), are found primarily in epithelia and cardiac muscle where they constitute the adhesive proteins of the intercellular desmosome junctions and are required for cell adhesion and desmosome formation. Mutations in DSC2 gene are associated with arrhythmogenic right ventricular dysplasia-11.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for Desmocollin 2 antibody 60239-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-Desmocollin-2 antibody (Cat# 60239-1-Ig) has 7 citations spanning journals including Nature Microbiology, Stem Cell Research & Therapy, Journal of Cell Biology, Acta Physiologica, PLoS Pathogens, Molecular Therapy Oncolytics, and Heliyon. Research fields cover viral epithelial entry (EBV), epidermal stem cell biology, desmosomal adhesion and differentiation, cell–cell adhesion, gingival epithelial permeability, cancer metastasis/angiogenesis, and tumor microenvironment/immunotherapy. Applications include blocking assays, immunofluorescence, and Western blot in human samples.
| Species | Application | Title |
|---|---|---|
Nat Microbiol Epstein-Barr virus exploits desmocollin 2 as the principal epithelial cell entry receptor. | ||
Stem Cell Res Ther Both Wnt signaling and epidermal stem cell-derived extracellular vesicles are involved in epidermal cell growth. | ||
J Cell Biol DPM1 modulates desmosomal adhesion and epidermal differentiation through SERPINB5 | ||
Acta Physiol (Oxf) Clustering of desmosomal cadherins by desmoplakin is essential for cell-cell adhesion. | ||
PLoS Pathog Porphyromonas gingivalis induces penetration of lipopolysaccharide and peptidoglycan through the gingival epithelium via degradation of junctional adhesion molecule 1. | ||
Mol Ther Oncolytics Exosomal miR-205-5p enhances angiogenesis and nasopharyngeal carcinoma metastasis by targeting desmocollin-2. |
Reviews
What customers say
Both reviews tested this antibody by Western Blot in cardiomyocyte samples. One user at 1:200 dilution observed a weak, smeared band at the expected molecular weight but found the signal insufficient for quantitative analysis. The other user at 1:1000 dilution in hiPSC-derived cardiomyocytes reported a clear band around 130 kDa. Overall, the antibody detects the target in cardiac cell types, but signal strength and band sharpness may vary, and optimization of dilution and exposure conditions is recommended for reliable results.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Jane (Verified Customer) (02-03-2022) | A very weak and smear band found around the right molecular weight. However, the quality is not good enough to do any analysis or generate results.
|
Jing (Verified Customer) (02-04-2020) | Tested in hiPSC-derived cardiomyocytes, it showed band around 130Kd.
|
