Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CDX2 Monoclonal antibody

CDX2 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 60243-1-Ig
Clone No. 5A4E6
Publications (27)
Reviews (1)
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, pig and More (1)

Applications

WB, IHC, IF/ICC, ELISA

5A4E6, Caudal type homeobox 2, Caudal type homeobox protein 2, Caudal-type homeobox protein 2, CDX 3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for CDX2 in ?

Tested Applications

Positive WB detected inCOLO 320 cells, HT-29 cells, SW 1990 cells, pig colon tissue
Positive IF/ICC detected inCaco-2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60243-1-Ig targets CDX2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, pig samples.

Tested Reactivity human, pig
Cited Reactivityhuman, bovine
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17644

Product name: Recombinant human CDX2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-180 aa of BC014461

Sequence: MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQ

Predict reactive species
Full Name caudal type homeobox 2
Calculated Molecular Weight 313 aa, 34 kDa
Observed Molecular Weight 33-40 kDa
GenBank Accession NumberBC014461
Gene Symbol CDX2
Gene ID (NCBI) 1045
RRIDAB_2881365
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ99626
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CDX2, also named as Homeobox protein CDX-2, is a 313 amino acid protein, which contains one homeobox DNA-binding domain and belongs to the Caudal homeobox family. CDX2 localizes in the nucleus and is involved in the transcriptional regulation of multiple genes expression in the intestinal epithelium. The relative expression of CDX1 to CDX2 protein may be important in the anterior to posterior patterning of the intestinal epithelium and in defining patterns of proliferation and differentiation along the crypt-villus axis. Both Cdx1 and Cdx2 genes must be expressed to reduce tumorigenic potential, to increase sensitivity to apoptosis, and to reduce cell migration, suggesting that the two genes control the normal phenotype by independent pathways.

Protocols

Product Specific Protocols
IF protocol for CDX2 antibody 60243-1-IgDownload protocol
WB protocol for CDX2 antibody 60243-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

CDX2 Monoclonal antibody (5A4E6), catalog number 60243-1-Ig, has 27 citations published in journals including Journal of Advanced Research, Journal of Experimental & Clinical Cancer Research, Small, Cell Communication and Signaling, Cell Reports, iScience, Acta Pharmacologica Sinica, and others. Research fields span gastric/intestinal cancer, ferroptosis, inflammatory bowel disease, embryonic development, organoid biology, diabetic kidney disease, epithelial-mesenchymal transition, and intestinal barrier function.

SpeciesApplicationTitle
humanWB

J Adv Res

Phytosterol alleviates cholesterol accumulation by influencing intestinal esterification rather than competitive solubilization under dietary MUFA.

Authors - Tian Zhao
humanWB

J Exp Clin Cancer Res

FOLR2+ macrophage depletion from intestinal metaplasia to early gastric cancer: single-cell sequencing insight into gastric cancer progression

Authors - Yuxin He
humanIHC

J Exp Clin Cancer Res

IKBKE downregulation increases chemosensitivity through pyroptosis mediated by the caspase-3/GSDME pathway in pancreatic cancer.

Authors - Ting Ren
humanIHC,IF

Small

Biomimetic Human Intestinal Tumor-on-a-Chip with Crypts and Villus-Like Structures for Chemotherapy Drug Evaluations.

Authors - Jianhua Lu
humanWB,IF

Cell Commun Signal

Helicobacter pylori promotes gastric intestinal metaplasia through activation of IRF3-mediated kynurenine pathway

Authors - Xinhua Liang
humanWB

Cell Commun Signal

GZMA suppressed GPX4-mediated ferroptosis to improve intestinal mucosal barrier function in inflammatory bowel disease

Authors - Rongwei Niu

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The single review for this product is a 5-star rating from July 2025. The reviewer used the antibody at a 1:1000 dilution for both Western Blot and Immunohistochemistry, testing it on Caco-2 cells and animal colon tissue. They reported positive results without noting any issues, indicating reliable performance across both applications and sample types.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


A (Verified Customer) (07-15-2025)

Used for caco2 cells and animal colon tissue

  • Applications: Western Blot, Immunohistochemistry
  • Primary Antibody Dilution: 1 to 1000
Loading...
||
New chat

Able™

正在加载,请稍候...