Tested Applications
| Positive WB detected in | COLO 320 cells, HT-29 cells, SW 1990 cells, pig colon tissue |
| Positive IF/ICC detected in | Caco-2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
60243-1-Ig targets CDX2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, pig samples.
| Tested Reactivity | human, pig |
| Cited Reactivity | human, bovine |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17644 Product name: Recombinant human CDX2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-180 aa of BC014461 Sequence: MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQ Predict reactive species |
| Full Name | caudal type homeobox 2 |
| Calculated Molecular Weight | 313 aa, 34 kDa |
| Observed Molecular Weight | 33-40 kDa |
| GenBank Accession Number | BC014461 |
| Gene Symbol | CDX2 |
| Gene ID (NCBI) | 1045 |
| RRID | AB_2881365 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q99626 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CDX2, also named as Homeobox protein CDX-2, is a 313 amino acid protein, which contains one homeobox DNA-binding domain and belongs to the Caudal homeobox family. CDX2 localizes in the nucleus and is involved in the transcriptional regulation of multiple genes expression in the intestinal epithelium. The relative expression of CDX1 to CDX2 protein may be important in the anterior to posterior patterning of the intestinal epithelium and in defining patterns of proliferation and differentiation along the crypt-villus axis. Both Cdx1 and Cdx2 genes must be expressed to reduce tumorigenic potential, to increase sensitivity to apoptosis, and to reduce cell migration, suggesting that the two genes control the normal phenotype by independent pathways.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CDX2 antibody 60243-1-Ig | Download protocol |
| WB protocol for CDX2 antibody 60243-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
CDX2 Monoclonal antibody (5A4E6), catalog number 60243-1-Ig, has 27 citations published in journals including Journal of Advanced Research, Journal of Experimental & Clinical Cancer Research, Small, Cell Communication and Signaling, Cell Reports, iScience, Acta Pharmacologica Sinica, and others. Research fields span gastric/intestinal cancer, ferroptosis, inflammatory bowel disease, embryonic development, organoid biology, diabetic kidney disease, epithelial-mesenchymal transition, and intestinal barrier function.
| Species | Application | Title |
|---|---|---|
J Adv Res Phytosterol alleviates cholesterol accumulation by influencing intestinal esterification rather than competitive solubilization under dietary MUFA. | ||
J Exp Clin Cancer Res FOLR2+ macrophage depletion from intestinal metaplasia to early gastric cancer: single-cell sequencing insight into gastric cancer progression | ||
J Exp Clin Cancer Res IKBKE downregulation increases chemosensitivity through pyroptosis mediated by the caspase-3/GSDME pathway in pancreatic cancer. | ||
Small Biomimetic Human Intestinal Tumor-on-a-Chip with Crypts and Villus-Like Structures for Chemotherapy Drug Evaluations. | ||
Cell Commun Signal Helicobacter pylori promotes gastric intestinal metaplasia through activation of IRF3-mediated kynurenine pathway | ||
Cell Commun Signal GZMA suppressed GPX4-mediated ferroptosis to improve intestinal mucosal barrier function in inflammatory bowel disease |
Reviews
What customers say
The single review for this product is a 5-star rating from July 2025. The reviewer used the antibody at a 1:1000 dilution for both Western Blot and Immunohistochemistry, testing it on Caco-2 cells and animal colon tissue. They reported positive results without noting any issues, indicating reliable performance across both applications and sample types.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
A (Verified Customer) (07-15-2025) | Used for caco2 cells and animal colon tissue
|









