BID Monoclonal antibody, PBS Only (Capture)

Name: BID Monoclonal antibody, PBS Only (Capture), 100ug
Brand: Proteintech
SKU: 60301-1-PBS-100UG

BID Monoclonal Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 60301-1-PBS

Clone No. 2A2E5

Review Product

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

Synonyms

p22 BID, 2A2E5, BH3 interacting domain death agonist, BH3-interacting domain death agonist, BH3-interacting domain death agonist p11

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF/ICCCytometric bead array sample testCytometric bead array

WB analysis of HeLa using 60301-1-Ig (same clone as 60301-1-PBS)
WB result of BID antibody (60301-1-Ig, 1:8000) with si-Control and si-BID transfected HeLa cells. This data was developed using the same antibody clone with 60301-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HeLa using 60301-1-Ig (same clone as 60301-1-PBS)
HeLa cells were subjected to SDS PAGE followed by western blot with 60301-1-Ig (BID Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60301-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of Jurkat using 60301-1-Ig (same clone as 60301-1-PBS)
Jurkat cells were subjected to SDS PAGE followed by western blot with 60301-1-Ig (BID Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60301-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 60301-1-Ig (same clone as 60301-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60301-1-Ig (BID Antibody) at dilution of 1:900 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60301-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 60301-1-Ig (same clone as 60301-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 60301-1-Ig (BID Antibody) at dilution of 1:900 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60301-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HeLa using 60301-1-Ig (same clone as 60301-1-PBS)
Immunofluorescent analysis of HeLa cells using 60301-1-Ig (BID antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Mouse IgG (H+L). This data was developed using the same antibody clone with 60301-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Cytometric bead array sample test of MP51897-1
Cytometric bead array sample test of MP51897-1, BID Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 60301-1-PBS. Detection antibody: 60301-2-PBS.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Cytometric bead array standard curve of MP51897-1
Cytometric bead array standard curve of MP51897-1, BID Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 60301-1-PBS. Detection antibody: 60301-2-PBS. Standard:Ag21005. Range: 0.391-50 ng/mL.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for BID in ?

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

60301-1-PBS targets BID as part of a matched antibody pair:

MP51897-1: 60301-1-PBS capture and 60301-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity	human
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag21005 Product name: Recombinant human BID protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-195 aa of BC009197 Sequence: MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD Predict reactive species
Full Name	BH3 interacting domain death agonist
Calculated Molecular Weight	22 kDa
Observed Molecular Weight	22 kDa
GenBank Accession Number	BC009197
Gene Symbol	BID
Gene ID (NCBI)	637
RRID	AB_2881416
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P55957
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

BID, also named as p22 BID, can be cleaved into p11 BID, p13 BID and p15 BID. It is pro-apoptotic molecules. The major proteolytic product p15 BID allows the release of cytochrome c. BID-L, BID-EL and BID-ES induce ICE-like proteases and apoptosis. BID-S does not induce apoptosis. BID counters the protective effect of Bcl-2. (PMID:14583606).