LMOD1 Monoclonal antibody, PBS Only (Detector)

LMOD1 Monoclonal Antibody for WB, IHC, IF-P, Cytometric bead array, Indirect ELISA, Sample test
Cat No. 60414-1-PBS
Clone No.1D6H2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF-P, Cytometric bead array, Indirect ELISA, Sample test

1D6H2, Leiomodin1, Leiomodin-1, SM-Lmod, Thyroid-associated ophthalmopathy autoantigen

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60414-1-PBS targets LMOD1 as part of a matched antibody pair:

MP51375-1: 60414-2-PBS capture and 60414-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7568

Product name: Recombinant human LMOD1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-269 aa of BC001755

Sequence: MEELEKELDVVDPDGSVPVGLRQRNQTEKQSTGVYNREAMLNFCEKETKKLMQREMSMDESKQVETKTDAKNGEERGRDASKKALGPRRDSDLGKEPKRGGLKKSFSRDRDEAGGKSGEKPKEEKIIRGIDKGRVRAAVDKKEAGKDGRGEERAVATKKEEEKKGSDRNTGLSRDKDKKREEMKEVAKKEDDEKVKGGAPAAPPPPPPPLAPPLIMENLKNSLSPATQRKMGDKVLPAQEKNSRDQLLAAIRSSNLKQLKKVEVPKLLQ

Predict reactive species
Full Name leiomodin 1 (smooth muscle)
Calculated Molecular Weight 67 kDa
Observed Molecular Weight 75 kDa
GenBank Accession NumberBC001755
Gene Symbol LMOD1
Gene ID (NCBI) 25802
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP29536
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

LMOD1 was initially identified as a 64-kDa autoantigen in an expression screen with sera from patients with Hashimoto's thyroiditis. Recently immunohistochemistry and immunoblotting of LMOD1 demonstrated its highly restrictive pattern of expression in SMC lineages,like adult aorta, and bladder. LMOD1 is also shown to exhibit an embryonic and adult expression pattern. These data identify LMOD1 as a new SMC-restricted gene associated with the SMC differentiated phenotype.

Loading...
||
New chat

Able

正在加载,请稍候...