MMP-9 Monoclonal antibody

MMP-9 Monoclonal Antibody for WB, ELISA
Cat No. 60600-1-Ig
Clone No.3C3E2

Host / Isotype

Mouse / IgG1

Reactivity

human and More (1)

Applications

WB, ELISA

MMP9, 67 kDa matrix metalloproteinase-9, 82 kDa matrix metalloproteinase-9, CLG4B, EC:3.4.24.35

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inU2OS cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

60600-1-Ig targets MMP-9 in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivitymouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Eg0442

Product name: Recombinant Human MMP9 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*His

Domain: 20-707 aa of BC006093

Sequence: APRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTRDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED

Predict reactive species
Full Name matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)
Calculated Molecular Weight 707 aa, 78 kDa
Observed Molecular Weight 92 kDa
GenBank Accession NumberBC006093
Gene Symbol MMP-9
Gene ID (NCBI) 4318
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP14780
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, tissue remodeling, and disease processes, such as arthritis or metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. Matrix metalloproteinase 9 (gelatinase B, 92 kDa gelatinase, 92 kDa type IV collagenase) (MMP9, synonyms: GELB, CLG4B) degrades collagens type IV and V. Studies in rhesus monkeys suggest that MMP9 is involved in IL-8-induced mobilization hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling (PMID:7492685).

Protocols

Product Specific Protocols
WB protocol for MMP-9 antibody 60600-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Aging Dis

ATF4 Contributes to Abdominal Aortic Aneurysm Formation via Modulating M1 Macrophage Polarization and Inflammation

Authors - Huahui Yu
Loading...
||
New chat Able
正在加载,请稍候...