HSD17B4 Monoclonal antibody, PBS Only (Capture)

HSD17B4 Monoclonal Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 60951-1-PBS
Clone No.1A3H11

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

(3R)-hydroxyacyl-CoA dehydrogenase, 17 beta HSD 4, 17-beta-HSD 4, 17-beta-hydroxysteroid dehydrogenase 4, D bifunctional protein

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60951-1-PBS targets HSD17B4 as part of a matched antibody pair:

MP51363-1: 60951-1-PBS capture and 60951-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7221

Product name: Recombinant human HSD17B4 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 436-736 aa of BC003098

Sequence: GSGVVIIMDVYSYSEKELICHNQFSLFLVGSGGFGGKRTSDKVKVAVAIPNRPPDAVLTDTTSLNQAALYRLSGDWNPLHIDPNFASLAGFDKPILHGLCTFGFSARRVLQQFADNDVSRFKAIKARFAKPVYPGQTLQTEMWKEGNRIHFQTKVQETGDIVISNAYVDLAPTSGTSAKTPSEGGKLQSTFVFEEIGRRLKDIGPEVVKKVNAVFEWHITKGGNIGAKWTIDLKSGSGKVYQGPAKGAADTTIILSDEDFMEVVLGKLDPQKAFFSGRLKARGNIMLSQKLQMILKDYAKL

Predict reactive species
Full Name hydroxysteroid (17-beta) dehydrogenase 4
Calculated Molecular Weight 80 kDa
Observed Molecular Weight 80 kDa, 45 kDa
GenBank Accession NumberBC003098
Gene Symbol HSD17B4
Gene ID (NCBI) 3295
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP51659
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

HSD17B4 (17-beta-hydroxysteroid dehydrogenase 4) is also named as Peroxisomal multifunctional enzyme type 2, D-bifuntional protein or multifunctional protein 2. It codes for a 80 kDa enzyme containing three distinct functional domains and is localized in peroxisomes. It is a bifunctional enzyme acting on the peroxisomal beta-oxidation pathway for fatty acids and catalyzing the formation of 3-ketoacyl-CoA intermediates from both straight-chain and 2-methyl-brancked-chian fatty acids. After peroxisomal import, the full-length protein is proteolytically cleaved to yield a 35-kDa dehydrogenase subunit and a 45-kDa hydratase subunit containing the hydratase and SCP domains (PMID: 28868548, 24602372).

Loading...
||
New chat

Able

正在加载,请稍候...