Product Information
61061-1-PBS targets HIF3A as part of a matched antibody pair:
MP51633-1: 61060-1-PBS capture and 61061-1-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag34542 Product name: Recombinant human HIF3A protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 401-486 aa of NM_022462 Sequence: MALAADPRRFCSPDLRRLLGPILDGASVAATPSTPLATRHPQSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDLDIAQDADALD Predict reactive species |
| Full Name | hypoxia inducible factor 3, alpha subunit |
| Calculated Molecular Weight | 72 kDa |
| GenBank Accession Number | NM_022462 |
| Gene Symbol | HIF3A |
| Gene ID (NCBI) | 64344 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G Magarose purification |
| UNIPROT ID | Q9Y2N7 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
