Product Information
61116-1-PBS targets TFF3 as part of a matched antibody pair:
MP51755-1: 61116-1-PBS capture and 61116-2-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9543 Product name: Recombinant human TFF3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC017859 Sequence: MAARALCMLGLVLALLSSSSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF Predict reactive species |
| Full Name | trefoil factor 3 (intestinal) |
| Calculated Molecular Weight | 80 aa, 9 kDa |
| GenBank Accession Number | BC017859 |
| Gene Symbol | TFF3 |
| Gene ID (NCBI) | 7033 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q07654 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
