Tested Applications
| Positive WB detected in | A549 cells, Jurkat cells, Raji cells, U-937 cells, MOLT-4 cells, Ramos cells, Daudi cells, HL-60 cells, RAW 264.7 cells |
| Positive IF-P detected in | human tonsillitis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66148-1-Ig targets IL-17A in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, rabbit |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3733 Product name: Recombinant human IL-17A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-155 aa of BC067505 Sequence: MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA Predict reactive species |
| Full Name | interleukin 17A |
| Calculated Molecular Weight | 155 aa, 18 kDa |
| Observed Molecular Weight | 18 kDa |
| GenBank Accession Number | BC067505 |
| Gene Symbol | IL-17A |
| Gene ID (NCBI) | 3605 |
| ENSEMBL Gene ID | ENSG00000112115 |
| RRID | AB_2881544 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q16552 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
IL17A, also named as IL-17, is a proinflammatory cytokine. IL-17, synthesized only by memory T cells and natural killer cells, has pleiotropic effects, mainly in the recruitment and activation of neutrophils. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. The IL-17 receptor is a type I transmembrane protein, that is widely expressed on epithelial cells, fibroblasts, B and T cells, and monocytic cells. In psoriatic skin lesions, both Th17 cells and their downstream effector molecules, e.g. IL-17 and IL-22, are highly increased.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for IL-17A antibody 66148-1-Ig | Download protocol |
| WB protocol for IL-17A antibody 66148-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The IL-17A Monoclonal antibody (catalog number 66148-1-Ig) has 81 total citations, spanning journals including Nature Communications, Bioactive Materials, Autophagy, Metabolism, Gut Microbes, Theranostics, Advanced Science, Biomaterials, Phytomedicine, EBioMedicine, Cell Death Discovery, JCI Insight, FASEB Journal, PLoS One, eLife, and Frontiers in Immunology. Associated research fields include immunology, inflammatory and autoimmune diseases, cancer, wound healing, neurology, respiratory disease, metabolic disorders, infectious disease, dermatology, and tissue repair.
| Species | Application | Title |
|---|---|---|
Bioact Mater Cu-DHM nanozymes treat flap ischemia-reperfusion injury by amplifying immune modulation in a cascade manner and inhibiting cell apoptosis | ||
Bioact Mater Engineering a halloysite nanotube-enhanced hydrogel 3D skin model for modulated inflammation and accelerated wound healing | ||
Autophagy IL17A disrupts autophagy-lysosomal function and lysosome reformation through the GSK3B-TFE3 signaling pathway in Huntington disease. | ||
Nat Commun Immunocompatible elastomer with increased resistance to the foreign body response | ||
Nat Commun Engineered exosome nanovesicles for delivery of antibodies to treat inflammatory bowel disease. | ||
Metabolism Setmelanotide alleviates diabetes-associated cognitive impairment by interrupting the binding of ICAM-1 and JIP1 in endothelial cells of the blood-brain barrier. |
Reviews
What customers say
The product received a single 5-star review from a user who tested it for immunofluorescence on adipose tissue at a 1:150 dilution. The reviewer included an image demonstrating successful staining results, though no written comments were provided. Overall, the feedback indicates strong performance in IF applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Rosa (Verified Customer) (07-08-2022) |
 |
