Tested Applications
| Positive WB detected in | human skeletal muscle tissue, pig heart tissue, rat heart tissue, mouse heart tissue, rabbit heart tissue, human heart tissue | 
| Positive IHC detected in | human heart tissue, mouse tongue tissue,  rat heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
| Positive FC (Intra) detected in | C2C12 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:5000-1:80000 | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below | 
Product Information
66205-1-Ig targets Myoglobin in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.
| Tested Reactivity | human, mouse, rat, pig, rabbit | 
| Cited Reactivity | pig | 
| Host / Isotype | Mouse / IgG1 | 
| Class | Monoclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag8979 Product name: Recombinant human MB protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-154 aa of BC014547 Sequence: MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG Predict reactive species | 
                                    
| Full Name | myoglobin | 
| Calculated Molecular Weight | 154 aa, 17 kDa | 
| Observed Molecular Weight | 17-18 kDa | 
| GenBank Accession Number | BC014547 | 
| Gene Symbol | Myoglobin | 
| Gene ID (NCBI) | 4151 | 
| RRID | AB_2881596 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Protein G purification | 
| UNIPROT ID | P02144 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
Myoglobin is a cytoplasmic hemoprotein that is expressed primarily in cardiomyocytes and oxidative skeletal muscle fibers, functioning on facilitating oxygen transport and modulating nitric oxide homeostasis within cardiac and skeletal myocytes. Recent studies indicated that myoglobin was also expressed in non-muscle tissues. This antibody well recognized endogenous myoglobin in muscle lysates.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Myoglobin antibody 66205-1-Ig | Download protocol | 
| IHC protocol for Myoglobin antibody 66205-1-Ig | Download protocol | 
| WB protocol for Myoglobin antibody 66205-1-Ig | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Stress Biol Time-restricted feeding relieves high temperature-induced impairment on meat quality by activating the Nrf2/HO-1 pathway, modification of muscle fiber composition, and enriching the polyunsaturated fatty acids in pigs | 



















