Tested Applications
| Positive IF/ICC detected in | C2C12 cells | 
| Positive FC (Intra) detected in | C2C12 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 | 
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-66205 targets Myoglobin in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse | 
| Host / Isotype | Mouse / IgG1 | 
| Class | Monoclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag8979 Product name: Recombinant human MB protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-154 aa of BC014547 Sequence: MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG Predict reactive species | 
                                    
| Full Name | myoglobin | 
| Calculated Molecular Weight | 154 aa, 17 kDa | 
| Observed Molecular Weight | 17-18 kDa | 
| GenBank Accession Number | BC014547 | 
| Gene Symbol | Myoglobin | 
| Gene ID (NCBI) | 4151 | 
| RRID | AB_3084221 | 
| Conjugate | CoraLite® Plus 488 Fluorescent Dye | 
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm | 
| Form | Liquid | 
| Purification Method | Protein G purification | 
| UNIPROT ID | P02144 | 
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. | 
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
Myoglobin is a cytoplasmic hemoprotein that is expressed primarily in cardiomyocytes and oxidative skeletal muscle fibers, functioning on facilitating oxygen transport and modulating nitric oxide homeostasis within cardiac and skeletal myocytes. Recent studies indicated that myoglobin was also expressed in non-muscle tissues. This antibody well recognized endogenous myoglobin in muscle lysates.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL Plus 488 Myoglobin antibody CL488-66205 | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 



