Calsequestrin 2 Monoclonal antibody

Calsequestrin 2 Monoclonal Antibody for WB, IHC, IF-P, ELISA
Cat No. 66419-1-Ig
Clone No.1C10A1

Host / Isotype

Mouse / IgG2a

Reactivity

human, rat, pig, mouse

Applications

WB, IHC, IF-P, ELISA

Calsequestrin 2, CASQ2, PDIB2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inpig heart tissue, human skeletal muscle tissue, rat skeletal muscle tissue, mouse skeletal muscle tissue, human heart tissue, pig skeletal muscle tissue, rat heart tissue, mouse heart tissue
Positive IHC detected inhuman heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse heart tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IHCSee 1 publications below

Product Information

66419-1-Ig targets Calsequestrin 2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, rat, pig, mouse samples.

Tested Reactivity human, rat, pig, mouse
Cited Reactivityhuman
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag13246

Product name: Recombinant human CASQ2 protein

Source: e coli.-derived, T-HIS

Tag: 6*His

Domain: 1-399 aa of BC022288

Sequence: MKRTHLFIVGIYFLSSCRAEEGLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPVSSDKVTQKQFQLKEIVLELVAQVLEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLYILKGDRTIEFDGEFAADVLVEFLLDLIEDPVEIISSKLEVQAFERIEDYIKLIGFFKSEDSEYYKAFEEAAEHFQPYIKFFATFDKGVAKKLSLKMNEVDFYEPFMDEPIAIPNKPYTEEELVEFVKEHQRPTLRRLRPEEMFETWEDDLNGIHIVAFAEKSDPDGYEFLEILKQVARDNTDNPDLSILWIDPDDFPLLVAYWEKTFKIDLFRPQIGVVNVTDADSVWMEIPDDDDLPTAEELEDWIEDVLSGKINTEDDDEDDDDDDNSDEEDNDDSDDDDDE

Predict reactive species
Full Name calsequestrin 2 (cardiac muscle)
Calculated Molecular Weight 46 kDa
Observed Molecular Weight 50 kDa
GenBank Accession NumberBC022288
Gene Symbol Calsequestrin 2
Gene ID (NCBI) 845
RRIDAB_2881791
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO14958
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Calsequestrin (CASQ) is a Ca2+-binding protein present primarily in junctional sarcoplasmic reticulum of skeletal and cardiac muscle; the cardiac form (CASQ2) is encoded by a separate gene. The primary role of CASQ2 is buffering of the sarcoplasmic reticulum Ca2+ ions, but another role for CASQ2 has emerged recently: CASQ2 regulates the open probability of ryanodine receptor 2 (RyR2). Mutations in CASQ2 cause stress-induced polymorphic ventricular tachycardia, also referred to as catecholaminergic polymorphic ventricular tachycardia 2 (CPVT2), a disease characterized by bidirectional ventricular tachycardia that may lead to cardiac arrest.

Protocols

Product Specific Protocols
IF protocol for Calsequestrin 2 antibody 66419-1-IgDownload protocol
IHC protocol for Calsequestrin 2 antibody 66419-1-IgDownload protocol
WB protocol for Calsequestrin 2 antibody 66419-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

J Neuropathol Exp Neurol

Morphological Alterations of the Sarcotubular System in Permanent Myopathy of Hereditary Hypokalemic Periodic Paralysis with a Mutation in the CACNA1S Gene.

Authors - Takamura Nagasaka
Loading...
||
New chat Able
正在加载,请稍候...