Use Able AI chat for product recommendations

KChIP1 Monoclonal antibody

KChIP1 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 66439-1-Ig
Clone No. 3D6C1
Publications (1)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, IF-P, ELISA

KCHIP1, KCNIP1, VABP, Vesicle APC binding protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for KChIP1 in ?

Tested Applications

Positive WB detected inhuman cerebellum tissue, fetal human brain tissue, human spleen tissue
Positive IHC detected inhuman brain tissue, human heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66439-1-Ig targets KChIP1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag5494

Product name: Recombinant human KCNIP1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-216 aa of BC050375

Sequence: MGAVMGTFSSLQTKQRRPSKDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVLYRGFKNECPSGVVNEDTFKQIYAQFFPHGDASTYAHYLFNAFDTTQTGSVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQKMDKNKDGIVTLDEFLESCQEDDNIMRSLQLFQNVM

Predict reactive species
Full Name Kv channel interacting protein 1
Calculated Molecular Weight 227 aa, 27 kDa
Observed Molecular Weight 25 kDa
GenBank Accession NumberBC050375
Gene Symbol KCNIP1
Gene ID (NCBI) 30820
RRIDAB_2881809
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9NZI2
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human K(v) channel interacting protein 1 (KCHIP1) is a new member of the neural calcium binding protein superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. KChIP1 is a neuronal calcium sensor protein that is predominantly expressed at GABAergic synapses and it has been related with modulation of K(+) channels, GABAergic transmission and cell death.

Protocols

Product Specific Protocols
IF protocol for KChIP1 antibody 66439-1-IgDownload protocol
IHC protocol for KChIP1 antibody 66439-1-IgDownload protocol
WB protocol for KChIP1 antibody 66439-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Antibody: Neuroligin-1 (NLGN1), Catalog No. 66439-1-Ig. Total citations: 1. The single citation appears in Nature Communications (IF 18.1), published in 2026. The associated research field is neuroscience, specifically investigating how Neuroligin1 in CCK-interneurons gates social memory formation via a disinhibitory microcircuit in the hippocampal CA2 region of male mice.

SpeciesApplicationTitle

Nat Commun

Neuroligin1 in CCK-interneurons gates social memory formation via a disinhibitory microcircuit in the hippocampal CA2 in male mice.

Authors - Miao Wu
Loading...
||
New chat

Able™

正在加载,请稍候...