Tested Applications
| Positive WB detected in | SK-N-SH cells, BxPC-3 cells, HEK-293 cells, human placenta tissue, MCF-7 cells, Neuro-2a cells, SGC-7901 cells, ROS1728 cells, BT-549 cells |
| Positive IHC detected in | human breast cancer tissue, human colon tissue, human colon cancer tissue, human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human breast cancer tissue, mouse spleen tissue |
| Positive IF-Fro detected in | mouse breast cancer |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:4000-1:16000 |
| Immunofluorescence (IF)-P | IF-P : 1:4000-1:16000 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66491-1-Ig targets Periostin in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, goat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14487 Product name: Recombinant human POSTN protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 21-368 aa of BC106710 Sequence: ANNHYDKILAHSRIRGRDQGPNVCALQQILGTKKKYFSTCKNWYKKSICGQKTTVLYECCPGYMRMEGMKGCPAVLPIDHVYGTLGIVGATTTQRYSDASKLREEIEGKGSFTYFAPSNEAWDNLDSDIRRGLESNVNVELLNALHSHMINKRMLTKDLKNGMIIPSMYNNLGLFINHYPNGVVTVNCARIIHGNQIATNGVVHVIDRVLTQIGTSIQDFIEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEALMKYHILNTLQCSESIMGGAVFETLEGNTIEIGCDGDSITVNGIKMVNKKDIVTNNGVIHLIDQVLIPD Predict reactive species |
| Full Name | periostin, osteoblast specific factor |
| Calculated Molecular Weight | 93 kDa |
| Observed Molecular Weight | 85-90 kDa |
| GenBank Accession Number | BC106710 |
| Gene Symbol | Periostin |
| Gene ID (NCBI) | 10631 |
| RRID | AB_2881856 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q15063 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Periostin (POSTN, PN), originally named as osteoblast-specific factor 2 (OSF-2), is a 90-kDa secreted protein which is now classified as a matricellular protein. It is present in a wide variety of normal adult tissues and fetal tissues, and has a role in bone, tooth and heart development and function. Studies show that periostin is overexpressed in a broad range of human cancer types, including lung, ovary, breast and colon cancers. Recent evidence reveals that periostin is expressed by fibroblasts in the normal tissue and in the stroma of the primary tumour, and it is required to allow cancer stem cell maintenance. The isoforms of periostin are between 83 and 93 kDa in mass and differ in their C-terminal sequences, characterized by individual presence or absence of cassette exons 17-21 (UniProtKB/Swiss-Prot, PMID: 21997759).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Periostin antibody 66491-1-Ig | Download protocol |
| IHC protocol for Periostin antibody 66491-1-Ig | Download protocol |
| WB protocol for Periostin antibody 66491-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Periostin Monoclonal Antibody (Cat# 66491-1-Ig) has 58 citations. They appear in journals including Nature Communications, Cell Metabolism, Advanced Materials, Advanced Science, Cancer Letters, Theranostics, EBioMedicine, Arthritis & Rheumatology, Cell Reports, Molecular Therapy, FASEB Journal, and Scientific Reports. Research fields span cancer biology (breast, gastric, colorectal, ovarian, glioma), cardiac and hepatic fibrosis, bone and tissue regeneration, immunology, and developmental biology.
| Species | Application | Title |
|---|---|---|
Cell Metab Myocardial infarction accelerates the progression of MASH by triggering immunoinflammatory response and induction of periosti | ||
Adv Mater Magnetoelectric Coupling Stimulation Modulates Macrophage Reprogramming for Superior Infected Periodontal Tissue Regeneration. | ||
Cancer Commun (Lond) Tryptophan 2,3-dioxygenase-positive matrix fibroblasts fuel breast cancer lung metastasis via kynurenine-mediated ferroptosis resistance of metastatic cells and T cell dysfunction | ||
Nat Commun Clec3b⁺ fibroblasts are the primary effectors of portal fibrosis following activation via a KLF4/periostin axis | ||
Nat Commun Tenascin C(+) myofibroblasts exacerbate vascular neointimal hyperplasia by propagation of nerve-macrophage interactions in mice. | ||
Nat Commun Intercellular chemerin-cmklr1 couples epicardial mechanosensing to fibroblasts in pressure overload. |
Reviews
What customers say
The antibody received a 5-star rating for immunofluorescence on human fibroblasts. The reviewer reported excellent staining performance, noting that the antibody worked well even at a high dilution factor of 1:500. Overall, the feedback highlights strong staining quality and good performance at dilute concentrations.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Niklas (Verified Customer) (11-08-2022) | great staining with even a high dilution factor
|
