Tested Applications
| Positive WB detected in | LNCaP cells, HEK-293 cells, HeLa cells, MCF-7 cells, Jurkat cells, HepG2 cells, K-562 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human breast cancer tissue, human prostate cancer tissue, human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66635-1-Ig targets FIS1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat, pig, goat, fish |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1409 Product name: Recombinant human FIS1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-152 aa of BC009428 Sequence: MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS Predict reactive species |
| Full Name | fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae) |
| Calculated Molecular Weight | 17 kDa |
| Observed Molecular Weight | 15 kDa |
| GenBank Accession Number | BC009428 |
| Gene Symbol | FIS1 |
| Gene ID (NCBI) | 51024 |
| RRID | AB_2881994 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q9Y3D6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Fis1 (fission 1) is an integral mitochondrial outer membrane protein that participates in mitochondrial fission by interacting with dynamin-related protein 1 (Drp1). Excessive mitochondrial fission is associated with the pathology of a number of neurodegenerative or neurodevelopmental diseases. Increased expression of Fis1 has been found in Huntington's disease (HD)-affected brain, Alzheimer's disease (AD) patients, and autism spectrum disorder. (21257639, 21459773, 23333625)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for FIS1 antibody 66635-1-Ig | Download protocol |
| IHC protocol for FIS1 antibody 66635-1-Ig | Download protocol |
| IP protocol for FIS1 antibody 66635-1-Ig | Download protocol |
| WB protocol for FIS1 antibody 66635-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The FIS1 Monoclonal antibody (catalog number 66635-1-Ig) has 38 citations. These appear in journals including Redox Biology, Advanced Science, Cell Death & Disease, Journal of Translational Medicine, Antioxidants, EMBO Reports, FASEB Journal, iScience, Journal of Pineal Research, Nutrients, and Frontiers in Immunology, among others. Research fields span mitochondrial dynamics and fission, mitophagy, oxidative stress, neurodegeneration, diabetes, reproductive biology, cardiovascular disease, cancer, and aging.
| Species | Application | Title |
|---|---|---|
Redox Biol Acetylated tau exacerbates learning and memory impairment by disturbing with mitochondrial homeostasis | ||
Adv Sci (Weinh) HIGD1A Alleviates Oxidative Stress Related Ovarian Hypofunction by Enhancing Granulosa Cell Functions via NF-κB/SOD2 Signaling Pathway | ||
Cell Death Dis USP33 alleviates FIS1-dependent mitochondrial fission and cardiac microvascular injury in diabetic cardiomyopathy via deubiquitinating and stabilizing ATG7. | ||
Cell Death Dis SENP3-FIS1 axis promotes mitophagy and cell survival under hypoxia
| ||
J Transl Med Procyanidin C1 ameliorates acidic pH stress induced nucleus pulposus degeneration through SIRT3/FOXO3-mediated mitochondrial dynamics | ||
Antioxidants (Basel) ScFv T1 Protects Against Mitochondrial Damage of SH-SY5Y Cells Caused by Extracellular Tau Aggregates. |
Reviews
What customers say
Both reviewers used this antibody for Western Blot and reported positive results. One tested it on T cells and rated it 4 stars, describing the performance as "very good." The other tested it on HeLa and HEK293 cells at a 1:1,000 dilution, giving it 5 stars and noting that the antibody "worked very well." Overall, users found the antibody reliable and effective for WB applications across different cell types.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Pierre (Verified Customer) (09-26-2025) | Very Good
|
Chun (Verified Customer) (06-19-2022) | This antibody worked very well.
|
