Use Able AI chat for product recommendations

CEBPB Monoclonal antibody

CEBPB Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66649-1-Ig
Clone No.2B6E10

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, ELISA

2B6E10, C EBP beta, C/EBP beta, C/EBP related protein 2, C/EBPbeta

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, L02 cells, HepG2 cells
Positive IHC detected inhuman lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

This antibody is not recommended for IF application.

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:150-1:600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66649-1-Ig targets CEBPB in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, monkey
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag20073

Product name: Recombinant human CEBPB protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-266 aa of BC007538

Sequence: MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKT

Predict reactive species
Full Name CCAAT/enhancer binding protein (C/EBP), beta
Calculated Molecular Weight 345 aa, 36 kDa
Observed Molecular Weight40-45 kDa
GenBank Accession NumberBC007538
Gene Symbol CEBPB
Gene ID (NCBI) 1051
RRIDAB_2882006
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP17676
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CCAAT/enhancer-binding protein beta (CEBPB), also known as LAP, is a important transcriptional activator in the regulation of genes involved in immune and inflammatory responses. It specifically binds to an IL-1 response element in the IL-6 gene. NF-IL6 also binds to regulatory regions of several acute-phase and cytokines genes. It probably plays a role in the regulation of acute-phase reaction, inflammation and hemopoiesis. The consensus recognition site is 5'-T[TG]NNGNAA[TG]-3'. Functions in brown adipose tissue (BAT) differentiation By similarity. Regulates the transcriptional induction of peroxisome proliferator-activated receptor gamma (PPARG). CEBPb mRNAs possess alternative translation-initiation codons, which result in the formation of truncated forms of the protein. All major isoforms of CEBPB (38, 34, and 20 kDa) are expressed, with the 34 and 20kDa isoforms being more abundant in preovulatory follicles and further increased in corpora lutea (CL)(PMID:15647458).The truncated protein of 18 kDa (relative to the 30 kDa full-length protein that is known as LAP, or p30 CEBPb or liver-activating protein) lacks a transactivation domain,also known as LIP (p19 CEBPb or liver-inhibitory protein), can form homodimers or heterodimerize with other family members and, as it lacks the transactivation domain, can attenuate the transcriptional activation properties of the other isoforms.(10051447). Three variants of CEBPBs have been detected in many cell types: a 46 kDa full-length liver-enriched transcription-activating protein (LAP1), a 42 kDa LAP2 and a 20-kDa liver-enriched transcription-inhibitory protein (LIP). These variants are the result of an alternative translation initiation due to a leaky ribosomal scanning mechanism.(PMID:18820298).

Protocols

Product Specific Protocols
IHC protocol for CEBPB antibody 66649-1-IgDownload protocol
WB protocol for CEBPB antibody 66649-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouseWB

Int J Biol Macromol

CircDYM attenuates microglial apoptosis via CEBPB/ZC3H4 axis in LPS-induced mouse model of depression

Authors - Zhongqiu Zhou
humanWB

Int J Mol Sci

Piperine Improves Lipid Dysregulation by Modulating Circadian Genes Bmal1 and Clock in HepG2 Cells.

Authors - Weiyun Zhang
monkeyWB

Stem Cell Res Ther

The effects of BMMSC treatment on lung tissue degeneration in elderly macaques.

Authors - Yu-Kun Yang
humanIHC

Mol Hum Reprod

Identification of transcription factors that regulate placental sFLT1 expression

Authors - Qing Yong
mouseWB

Appl Biochem Biotechnol

Mechanistic Insights Into the Anti-Obesity Effects of Gondoic Acid: Regulation of AMPK Signalling and Obesity Related Gene Expression in Obese Mice.

Authors - Riya Kar
ratIHC,IF

Chin Med J (Engl)

C/EBPβ-Lin28a positive feedback loop triggered by C/EBPβ hypomethylation enhances the proliferation and migration of vascular smooth muscle cells in restenosis.

Authors - Xiaojun Zhou
  • KD Validated

Reviews

    4.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Boyan (Verified Customer) (01-25-2019)

Good. It only works for human CEBPb protein, because the antigen of this antibody is targeting the N-terminus of the protein, which is not conserved in human and mouse.

  • Applications: Western Blot,
Loading...
||
New chat

Able

正在加载,请稍候...