Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

PPARA Monoclonal antibody

PPARA Monoclonal Antibody for WB, ELISA

Cat No. 66826-1-Ig
Clone No.1G1E10

Host / Isotype

Mouse / IgG1

Reactivity

human, rat and More (6)

Applications

WB, IHC, IF, CoIP, ChIP, ELISA

1G1E10, hPPAR, NR1C1, Peroxisome proliferator-activated receptor alpha, PPAR

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHSC-T6 cells, ROS1728 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66826-1-Ig targets PPARA in WB, IHC, IF, CoIP, ChIP, ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Cited Reactivityhuman, mouse, rat, pig, chicken, zebrafish, hamster, goat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7896

Product name: Recombinant human PPARA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-258 aa of BC000052

Sequence: MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPVGVCGCSGFSWQHGTSVVEDD

Predict reactive species
Full Name peroxisome proliferator-activated receptor alpha
Calculated Molecular Weight 52 kDa
Observed Molecular Weight 53 kDa
GenBank Accession NumberBC000052
Gene Symbol PPARA
Gene ID (NCBI) 5465
RRIDAB_2882169
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ07869
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Peroxisome proliferator-activated receptor alpha (PPARA) is a ligand-activated transcription factor that belongs to the PPAR nuclear receptor superfamily. PPARA is essential in the modulation of lipid transport and metabolism, mainly through activating mitochondrial and peroxisomal fatty acid β-oxidation pathways. In addition, PPARA seems to decrease inflammation mainly through direct interaction with NF-κB, causing inhibition of its signaling pathway or reducing the activated levels of NF-κB and subsequent inflammation. Furthermore, PPARA was implicated in the attenuation of oxidative stress in alcoholic liver disease when treated with polyenephosphatidylcholine through downregulation of ROS-generating enzymes such as ethanol-inducible cytochrome P450 2E1 (CYP2E1), acyl-CoA oxidase, and NADPH oxidase. PPARA exists two isoforms and molecular weight of PPARA isoforms are 52 kDa and 22 kDa. The ability of a retinoid X receptor (RXR) to heterodimerize with many nuclear receptors, including LXR, PPAR, NGF1B and RAR, underscores its pivotal role within the nuclear receptor superfamily. Among these heterodimers, PPAR:RXR is considered an important signalling mediator of both PPAR ligands, such as fatty acids, and 9-cis retinoic acid (9-cis RA), an RXR ligand. (PMID: 15103326 ). PPARA can form Heterodimer with RXRA and molecular weight of Heterodimer is about 110 kDa.

Protocols

Product Specific Protocols
WB protocol for PPARA antibody 66826-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouseWB

Nat Metab

Obesity impairs gut repair via AFABP-mediated iron overload in intestinal stem cells.

Authors - Zhiming Liu
mouseWB

Cell Mol Immunol

Macrophage-derived VISTA engages with LRIG1 and hinders gut epithelial repair in colitis

Authors - Mengyuan Li
mouseWB

Bioact Mater

A foam cell-targeted lipophagy restoration strategy stabilizes vulnerable atherosclerotic plaques.

Authors - Heng Li

Autophagy

Hypoxia-preconditioned dental pulp stem cells alleviate acetaminophen-induced liver failure via promoting MYC-HIF1A/HIF-1α-BNIP3-mediated mitophagy.

Authors - Junyi Li
humanWB

Nat Commun

Pharmacological inhibition of Lin28 promotes ketogenesis and restores lipid homeostasis in models of non-alcoholic fatty liver disease

Authors - Evangelia Lekka
humanWB

Nat Commun

Limitations in PPARα-dependent mitochondrial programming restrain the differentiation of human stem cell-derived β cells.

Authors - Anne C. Lietzke

Reviews

    4.5 out of 5
Add a review

2 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Manon (Verified Customer) (01-23-2026)

Lots of aspecifics bands , and the bands around 53kDa is not clear maybe change the dilution

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/3000
  • Cell Tissue Type: Fibroblasts

Tianyi (Verified Customer) (08-30-2024)

Antigen retrieval in Tris/EDTA buffer and secondary antibody in AF647.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Ovarian tissue
PPARA Antibody Immunofluorescence validation (1:100 dilution) in Ovarian tissue (Cat no:66826-1-Ig)
Loading...
||
New chat

Able™

正在加载,请稍候...