Use Able AI chat for product recommendations

CD126/IL-6R alpha Monoclonal antibody

CD126/IL-6R alpha Monoclonal Antibody for IHC, ELISA

Cat No. 66855-1-Ig
Clone No. 2A5F4
Publications (3)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IHC, IF, ELISA

CD126, IL-6R alpha, 2A5F4, gp80, IL 6 receptor subunit alpha

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for CD126/IL-6R alpha in ?

Tested Applications

Positive IHC detected inhuman liver cancer tissue, human tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66855-1-Ig targets CD126/IL-6R alpha in IHC, IF, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag18263

Product name: Recombinant human IL-6R protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 22-371 aa of BC132684

Sequence: PRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAG

Predict reactive species
Full Name interleukin 6 receptor
Calculated Molecular Weight 468 aa, 52 kDa
Observed Molecular Weight 80 kDa
GenBank Accession NumberBC132684
Gene Symbol IL-6R alpha
Gene ID (NCBI) 3570
RRIDAB_2882195
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP08887
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Interleukin-6 (IL-6) is a pleiotropic cytokine produced by a variety of cells during infection, trauma, and immunological challenge (PMID: 8274730). IL-6 acts via a receptor complex consisting of two distinct membrane-bound glycoproteins, an 80-kDa IL-6-binding subunit (IL-6R alpha, CD126, gp80) and a 130-kDa signal-transducing element (gp130, CD130). After binding of IL-6 to membrane-bound IL-6R alpha, the complex of IL-6 and IL-6R alpha associates with gp130, thus activating the receptor (PMID: 9716487). Expression of gp130 is found in almost all organs while expression of IL-6R alpha is predominantly confined to hepatocytes and leukocyte subpopulations (monocytes, neutrophils, T cells, and B cells) (PMID: 11149892). Soluble form of IL-6R alpha has been found in human serum and urine (PMID: 2529343; 1545125).

Protocols

Product Specific Protocols
IHC protocol for CD126/IL-6R alpha antibody 66855-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The antibody anti-IL-6 (Cat# 66855-1-Ig) has 3 total citations published in Advanced Science, Cell Death Discovery, and Frontiers in Immunology. The research fields span prostate cancer (ANXA2-mediated phagocytosis and enzalutamide resistance), triple-negative breast cancer (adipocyte–tumor crosstalk via IL-6/CXCL1 co-activation of STAT3/NF-κB), and cholangiocarcinoma (IL-6 pathway expression and clinical significance). Applications cited include immunofluorescence in human samples.

SpeciesApplicationTitle
humanIF

Adv Sci (Weinh)

ANXA2-mediated Phagocytosis Generates AR(+) Macrophages to Confer Enzalutamide Resistance in Prostate Cancer.

Authors - Yong Luo

Cell Death Discov

Adipocyte-derived IL6 and triple-negative breast cancer cell-derived CXCL1 co-activate STAT3/NF-κB pathway to mediate the crosstalk between adipocytes and triple-negative breast cancer cells

Authors - Guo-Tian Ruan
humanIF

Front Immunol

Expression and clinical significance of interleukin-6 pathway in cholangiocarcinoma

Authors - Dongqing Gu
Loading...
||
New chat

Able™

正在加载,请稍候...