• Featured Product
  • KD/KO Validated

YAP1 Monoclonal antibody

YAP1 antibodies are used to detect Yes-associated protein 1, a critical effector in the Hippo pathway, in studies of cell proliferation, organ size regulation, and cancer. Proteintech has an extensive range of YAP1 antibodies validated for WB, IHC, IF/ICC, IF-P, FC (Intra) IP, ELISA and more.
Cat No. 66900-1-Ig
Clone No.3A7A9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

yes associated protein 1, YAP, Transcriptional coactivator YAP1, Protein yorkie homolog, 65 kDa Yes associated protein

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inNCI-H1299 cells, HUVEC cells, HeLa cells, HSC-T6 cells, NIH/3T3 cells, MCF-7 cells, LNCaP cells, HEK-293 cells, HepG2 cells, NIH-3T3 cells, 4T1 cells
Positive IHC detected inhuman lung cancer tissue, human colon cancer tissue, human liver cancer tissue, human ovary tumor tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66900-1-Ig targets YAP1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, sheep
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28194

Product name: Recombinant human YAP1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 155-504 aa of BC038235

Sequence: PTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL

Predict reactive species
Full Name Yes-associated protein 1, 65kDa
Calculated Molecular Weight 504 aa, 54 kDa
Observed Molecular Weight65-75 kDa
GenBank Accession NumberBC038235
Gene Symbol YAP1
Gene ID (NCBI) 10413
RRIDAB_2882229
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP46937
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Yes-associated protein 1 (YAP1) is a transcriptional regulator which can act both as a coactivator and a corepressor and is the critical downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Plays a key role to control cell proliferation in response to cell contact. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. The presence of TEAD transcription factors are required for it to stimulate gene expression, cell growth, anchorage-independent growth, and epithelial mesenchymal transition (EMT) induction. Isoform 2 and isoform 3 can activate the C-terminal fragment (CTF) of ERBB4 (isoform 3).Increased expression seen in some liver and prostate cancers. Isoforms lacking the transactivation domain found in striatal neurons of patients with Huntington disease (at protein level). Phosphorylation of S381 primes YAP phosphorylation by CK1δ/ɛ, resulting in activation of a phosphodegron, thus generates a binding surface that interacts with a ubiquitin ligase, and leads to degradation by ubiquitination. (PMID: 20048001). The calcualted molecular weight of YAP1 is 54 kDa, but routinely observed at 65-75 kDa by Western Blot (PMID: 28230103, 33264286, 36255405).

Protocols

Product Specific Protocols
WB protocol for YAP1 antibody 66900-1-IgDownload protocol
IHC protocol for YAP1 antibody 66900-1-IgDownload protocol
IF protocol for YAP1 antibody 66900-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Mol Cancer

Co-transcriptional R-loops-mediated epigenetic regulation drives growth retardation and docetaxel chemosensitivity enhancement in advanced prostate cancer

Authors - Yufan Ying
humanIF

Nat Commun

Endothelial discoidin domain receptor 1 senses flow to modulate YAP activation

Authors - Jiayu Liu
humanWB

Nat Commun

Fusobacterium nucleatum reduces METTL3-mediated m6A modification and contributes to colorectal cancer metastasis.

Authors - Shujie Chen
  • KD Validated
humanWB,IHC

Cancer Lett

A novel antagonist of the CCL5/CCR5 axis suppresses the tumor growth and metastasis of triple-negative breast cancer by CCR5-YAP1 regulation

Authors - Ling Chen
  • KD Validated
human,mouseWB,IHC,IF,CoIP

Acta Pharmacol Sin

Adaptor protein CEMIP reduces the chemosensitivity of small cell lung cancer via activation of an SRC-YAP oncogenic module

Authors - Xiao-Ju Shen
humanWB,IF

Oncogene

The keratin 17/YAP/IL6 axis contributes to E-cadherin loss and aggressiveness of diffuse gastric cancer

Authors - Mengjie Li

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Udesh (Verified Customer) (11-26-2023)

Worked well at 1:1000 for WB

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Glioblastoma
FH

Joshua (Verified Customer) (01-29-2019)

Coverslips were fixed with 4%PFA+0.25% Triton-X-100. Primary staining was 1:500, secondary was 1:750 with rockland 488 anti-mouse overnight at 4C.Left panel: Control PANC1 cells.Right panel: PANC1 cells with YAP silencing

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: PANC1
YAP1 Antibody Immunofluorescence, validation (1:500 dilution) in PANC1 (Cat no:66900-1-Ig)
Loading...
||
New chat Able
正在加载,请稍候...