Tested Applications
| Positive WB detected in | MCF-7 cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, THP-1 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse brain tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67153-1-Ig targets DHX9 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12104 Product name: Recombinant human DHX9 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-300 aa of BC014246 Sequence: MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVASPPPLTDTPDTTANAEGDLPTTMGGPLPPHLALKAENNSEVGASGYGVPGPTWDRGANLKDYYSRKEEQEVQATLESEEVDLNAGLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIKQLGRRIFAREHGSNKKLAAQSCALSLVRQLYHLGVVEAYSGLTKKKEGETVEPYKVNLSQDLEHQLQNIIQELNLEILPP Predict reactive species |
| Full Name | DEAH (Asp-Glu-Ala-His) box polypeptide 9 |
| Calculated Molecular Weight | 1270 aa, 141 kDa |
| Observed Molecular Weight | 140 kDa |
| GenBank Accession Number | BC014246 |
| Gene Symbol | DHX9 |
| Gene ID (NCBI) | 1660 |
| RRID | AB_2882450 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q08211 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RNA helicases play important roles in transcription, RNA processing, translation, and RNA replication. DEAD box proteins are putative RNA helicases that have a characteristic Asp-Glu-Ala-Asp (DEAD) box as 1 of 8 highly conserved sequence motifs. DHX9 a member of the DEAH family of proteins, which possess a double-stranded RNA-binding domain (dsRBD) and a helicase domain [PMID:20569003]. It unwinds double-stranded DNA and RNA in a 3' to 5' direction. Alteration of secondary structure of DHX9 may subsequently influence interactions with proteins or other nucleic acids. It is also a component of the CRD-mediated complex that promotes MYC mRNA stability. In addition, it is involved with LARP6 in the stabilization of type I collagen mRNAs for CO1A1 and CO1A2[PMID: 19029303, 22190748].
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for DHX9 antibody 67153-1-Ig | Download protocol |
| IHC protocol for DHX9 antibody 67153-1-Ig | Download protocol |
| IP protocol for DHX9 antibody 67153-1-Ig | Download protocol |
| WB protocol for DHX9 antibody 67153-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The DHX9 Monoclonal antibody (Cat# 67153-1-Ig) has 12 citations published in journals including Nature Communications, J Am Chem Soc, Advanced Science, Science Advances, Cell Death & Disease, Cell Reports, Scientific Reports, Frontiers in Oncology, and Lasers in Medical Science. Research fields span genomic instability, viral RNA processing, DNA replication, nasopharyngeal carcinoma, interferon signaling, breast cancer autophagy, innate immunity, DNA repair, KRAS-MAPK pathway, Ewing sarcoma, and melanogenesis.
| Species | Application | Title |
|---|---|---|
Nat Commun Virus-modified paraspeckle-like condensates are hubs for viral RNA processing and their formation drives genomic instability | ||
Nat Commun DHX9 maintains epithelial homeostasis by restraining R-loop-mediated genomic instability in intestinal stem cells | ||
J Am Chem Soc Polymerase η Recruits DHX9 Helicase to Promote Replication across Guanine Quadruplex Structures | ||
Adv Sci (Weinh) Integrative Transcriptome-Wide Association Study With Expression Quantitative Trait Loci Colocalization Identifies a Causal VAMP8 Variant for Nasopharyngeal Carcinoma Susceptibility | ||
Cell Death Dis DHX9-mediated epigenetic silencing of BECN1 contributes to impaired autophagy and tumor progression in breast cancer via recruitment of HDAC5
|
