IRAK4 Monoclonal antibody

IRAK4 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67180-1-Ig

Clone No. 1A4C4

Publications (1)

Review Product

Download datasheet

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

1A4C4, EC:2.7.11.1, Interleukin-1 receptor-associated kinase 4, IPD1, IRAK 4

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF/ICC

WB analysis using 67180-1-Ig
Various lysates were subjected to SDS PAGE followed by western blot with 67180-1-Ig (IRAK4 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse pancreas using 67180-1-Ig
Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 67180-1-Ig (IRAK4 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human pancreas cancer using 67180-1-Ig
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 67180-1-Ig (IRAK4 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human placenta using 67180-1-Ig
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 67180-1-Ig (IRAK4 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human placenta using 67180-1-Ig
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 67180-1-Ig (IRAK4 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse kidney using 67180-1-Ig
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 67180-1-Ig (IRAK4 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse kidney using 67180-1-Ig
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 67180-1-Ig (IRAK4 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse stomach using 67180-1-Ig
Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 67180-1-Ig (IRAK4 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat pancreas using 67180-1-Ig
Immunohistochemical analysis of paraffin-embedded rat pancreas tissue slide using 67180-1-Ig (IRAK4 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat stomach using 67180-1-Ig
Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 67180-1-Ig (IRAK4 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HepG2 using 67180-1-Ig
Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using IRAK4 antibody (67180-1-Ig, Clone: 1A4C4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-phalloidin (red).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for IRAK4 in ?

Overview

Tested Applications
Product Information
Publications (1)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HeLa cells, Jurkat cells, THP-1 cells, K-562 cells
Positive IHC detected in	human placenta tissue, rat stomach tissue, mouse kidney tissue, rat pancreas tissue, human pancreas cancer tissue, mouse stomach tissue, mouse pancreas tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HepG2 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:3000
Immunohistochemistry (IHC)	IHC : 1:500-1:2000
Immunofluorescence (IF)/ICC	IF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67180-1-Ig targets IRAK4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human
Host / Isotype	Mouse / IgG2a
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag29174 Product name: Recombinant human IRAK4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-200 aa of BC013316 Sequence: MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALLQTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITVQQKQMPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVV Predict reactive species
Full Name	interleukin-1 receptor-associated kinase 4
Calculated Molecular Weight	52 kDa
Observed Molecular Weight	52 kDa
GenBank Accession Number	BC013316
Gene Symbol	IRAK4
Gene ID (NCBI)	51135
RRID	AB_2882476
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q9NWZ3
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IF protocol for IRAK4 antibody 67180-1-Ig	Download protocol
IHC protocol for IRAK4 antibody 67180-1-Ig	Download protocol
WB protocol for IRAK4 antibody 67180-1-Ig	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The IRAK4 Monoclonal antibody (1A4C4), catalog number 67180-1-Ig, has a total of 1 citation. The citation appears in the journal Helicobacter (2025), in a study investigating how galangin alleviates Helicobacter pylori-induced gastritis through TLR2 inhibition and modulation of MyD88-dependent inflammatory cascades. The research field is gastric inflammation and innate immune signaling.

Species	Application	Title
human	WB	Helicobacter Galangin Alleviates Helicobacter pylori Gastritis Through TLR2 Inhibition and Modulation of the MyD88-Dependent Inflammatory Cascades. Authors - Wuyinxiao Zheng View Article