Tested Applications
| Positive WB detected in | HepG2 cells, HeLa cells |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human liver cancer tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:20000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 14 publications below |
| IHC | See 6 publications below |
| IF | See 4 publications below |
Product Information
67221-1-Ig targets SLC31A1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28410 Product name: Recombinant human SLC31A1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-67 aa of BC013611 Sequence: MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFGFKNVELLFSGLVINTAG Predict reactive species |
| Full Name | solute carrier family 31 (copper transporters), member 1 |
| Calculated Molecular Weight | 21 kDa |
| Observed Molecular Weight | 32 kDa |
| GenBank Accession Number | BC013611 |
| Gene Symbol | SLC31A1 |
| Gene ID (NCBI) | 1317 |
| RRID | AB_2882512 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O15431 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for SLC31A1 antibody 67221-1-Ig | Download protocol |
| IF protocol for SLC31A1 antibody 67221-1-Ig | Download protocol |
| IHC protocol for SLC31A1 antibody 67221-1-Ig | Download protocol |
| WB protocol for SLC31A1 antibody 67221-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Front Mol Biosci Significance of cuproptosis- related genes in the diagnosis and classification of psoriasis | ||
J Virol Identification of Copper Transporter 1 as a Receptor for Feline Endogenous Retrovirus ERV-DC14.
| ||
Mol Biol Cell Adaptive protein synthesis in genetic models of copper deficiency and childhood neurodegeneration | ||
Front Immunol Identification of hub cuproptosis related genes and immune cell infiltration characteristics in periodontitis | ||
Cell Rep An updated inventory of genes essential for oxidative phosphorylation identifies a mitochondrial origin in familial Ménière's disease | ||
Heliyon Analysis of cuproptosis-related genes in prognosis and immune infiltration in grade 4 diffuse gliomas |

















