SLC31A1 Monoclonal antibody, PBS Only

• 

  WB analysis of HepG2 using 67221-1-Ig (same clone as 67221-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 67221-1-Ig (SLC31A1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67221-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67221-1-Ig (same clone as 67221-1-PBS)

  WB result of SLC31A1 antibody (67221-1-Ig; 1:12000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SLC31A1 transfected HeLa cells. This data was developed using the same antibody clone with 67221-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67221-1-Ig (same clone as 67221-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 67221-1-Ig (SLC31A1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67221-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67221-1-Ig (same clone as 67221-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67221-1-Ig (SLC31A1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67221-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67221-1-Ig (same clone as 67221-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67221-1-Ig (SLC31A1 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67221-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67221-1-Ig (same clone as 67221-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67221-1-Ig (SLC31A1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67221-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67221-1-Ig (same clone as 67221-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67221-1-Ig (SLC31A1 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67221-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human liver cancer using 67221-1-Ig (same clone as 67221-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using 67221-1-Ig (SLC31A1 antibody) at dilution of 1:100 and CoraLite488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67221-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human liver cancer using 67221-1-Ig (same clone as 67221-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using 67221-1-Ig (SLC31A1 antibody) at dilution of 1:100 and CoraLite488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67221-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

SLC31A1 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 67221-1-PBS

Clone No.1A4H5

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IHC, IF-P, ELISA

Synonyms

COPT1, 1A4H5, CTR1, Truncated CTR1 form

---

Product Information

67221-1-PBS targets SLC31A1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28410

  Product name: Recombinant human SLC31A1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-67 aa of BC013611

  Sequence: MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFGFKNVELLFSGLVINTAG

• Full Name: solute carrier family 31 (copper transporters), member 1
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC013611
• Gene Symbol: SLC31A1
• Gene ID (NCBI): 1317
• RRID: AB_2882512
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O15431
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.