Tested Applications
Positive IF-P detected in | human liver cancer tissue |
Recommended dilution
Application | Dilution |
---|---|
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
CL488-67221 targets SLC31A1 in IF-P applications and shows reactivity with Human samples.
Tested Reactivity | Human |
Host / Isotype | Mouse / IgG2b |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag28410 Product name: Recombinant human SLC31A1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-67 aa of BC013611 Sequence: MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFGFKNVELLFSGLVINTAG Predict reactive species |
Full Name | solute carrier family 31 (copper transporters), member 1 |
Calculated Molecular Weight | 21 kDa |
Observed Molecular Weight | 32 kDa |
GenBank Accession Number | BC013611 |
Gene Symbol | SLC31A1 |
Gene ID (NCBI) | 1317 |
RRID | AB_2919440 |
Conjugate | CoraLite® Plus 488 Fluorescent Dye |
Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | O15431 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Protocols
Product Specific Protocols | |
---|---|
IF protocol for CL Plus 488 SLC31A1 antibody CL488-67221 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |