CoraLite®594-conjugated SLC31A1 Monoclonal antibody

• 

  IF Staining of human liver cancer using CL594-67221

  Immunofluorescent analysis of (4% PFA) fixed human liver cancer tissue using CoraLite®594 SLC31A1 antibody (CL594-67221, Clone: 1A4H5 ) at dilution of 1:100.

• Featured Product
• KD/KO Validated

SLC31A1 Monoclonal Antibody for IF-P

Cat No. CL594-67221

Clone No.1A4H5

Host / Isotype

Mouse / IgG2b

Reactivity

Human

Applications

IF-P

Synonyms

Copper transporter 1, COPT1, CTR1, hCTR1, SLC31A1

---

Tested Applications

• Positive IF-P detected in: human liver cancer tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67221 targets SLC31A1 in IF-P applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28410

  Product name: Recombinant human SLC31A1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-67 aa of BC013611

  Sequence: MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFGFKNVELLFSGLVINTAG

• Full Name: solute carrier family 31 (copper transporters), member 1
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC013611
• Gene Symbol: SLC31A1
• Gene ID (NCBI): 1317
• RRID: AB_2920101
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O15431
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.