Filter: AllWBIHCIF/ICCCytometric bead array sample testCytometric bead array

WB analysis using 67244-1-Ig (same clone as 67244-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 67244-1-Ig (TPM4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67244-1-PBS in a different storage buffer formulation.
WB analysis using 67244-1-Ig (same clone as 67244-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 67244-1-Ig (TPM4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67244-1-PBS in a different storage buffer formulation.
WB analysis using 67244-1-Ig (same clone as 67244-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 67244-1-Ig (TPM4 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67244-1-PBS in a different storage buffer formulation.
WB analysis of A549 using 67244-1-Ig (same clone as 67244-1-PBS)
WB result of TPM4 antibody (67244-1-Ig; 1:8000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TPM4 transfected A549 cells. This data was developed using the same antibody clone with 67244-1-PBS in a different storage buffer formulation.
IHC staining of mouse heart using 67244-1-Ig (same clone as 67244-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 67244-1-Ig (TPM4 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67244-1-PBS in a different storage buffer formulation.
IHC staining of rat heart using 67244-1-Ig (same clone as 67244-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 67244-1-Ig (TPM4 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67244-1-PBS in a different storage buffer formulation.
IF Staining of MCF-7 using 67244-1-Ig (same clone as 67244-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using TPM4 antibody (67244-1-Ig, Clone: 2E12D12 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67244-1-PBS in a different storage buffer formulation.
Cytometric bead array sample test of MP51644-1
Cytometric bead array sample test of MP51644-1, TPM4 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67244-2-PBS. Detection antibody: 67244-1-PBS.
Cytometric bead array standard curve of MP51644-1
Cytometric bead array standard curve of MP51644-1, TPM4 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67244-2-PBS. Detection antibody: 67244-1-PBS. Standard:Ag6947. Range: 1.563-200 ng/mL.

Featured Product
KD/KO Validated

TPM4 Monoclonal antibody, PBS Only (Detector)

Name: TPM4 Monoclonal antibody, PBS Only (Detector)
Brand: Proteintech
SKU: 67244-1-PBS

TPM4 Monoclonal Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 67244-1-PBS

Clone No.2E12D12

Review Product

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

Synonyms

2E12D12, TM30p1, tropomyosin 4, Tropomyosin alpha 4 chain, Tropomyosin alpha-4 chain

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

67244-1-PBS targets TPM4 as part of a matched antibody pair:

MP51644-1: 67244-2-PBS capture and 67244-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity	human, mouse, rat, pig, rabbit
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag6947 Product name: Recombinant human TPM4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-248 aa of BC037576 Sequence: MAGLNSLEAVKRKIQALQQQADEAEDRAQGLQRELDGERERREKAEGDVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKCGDLEEELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTVAKLEKTIDDLEEKLAQAKEENVGLHQTLDQTLNELNCI Predict reactive species
Full Name	tropomyosin 4
Calculated Molecular Weight	248 aa, 29 kDa
Observed Molecular Weight	32-35 kDa
GenBank Accession Number	BC037576
Gene Symbol	TPM4
Gene ID (NCBI)	7171
ENSEMBL Gene ID	ENSG00000167460
RRID	AB_2882523
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein G purification
UNIPROT ID	P67936
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

TPM4 is a member of tropomyosins (TPMs), a multi-gene family of actin-binding proteins present in all eukaryotic cells. In muscle, TPMs are responsible for mediating contraction via regulation of the actin-myosin interaction. As to non-muscle cells, its proposed role is to stabilize the actin filaments by modulating the interaction with proteins that are responsible for the regulation of actin dynamics. The form of TPM4 in muscle has a higher molecular weight than the form found in non-muscle cells.