S100P Monoclonal antibody, PBS Only (Capture)

S100P Monoclonal Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 67485-1-PBS
Clone No.1G6C3

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

S100 calcium binding protein P, Protein S100-P, Protein S100-E, Protein S100 P, Migration-inducing gene 9 protein

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67485-1-PBS targets S100P as part of a matched antibody pair:

MP51168-2: 67485-1-PBS capture and 67485-4-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag19115

Product name: Recombinant human S100P protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-95 aa of BC006819

Sequence: MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK

Predict reactive species
Full Name S100 calcium binding protein P
Calculated Molecular Weight 95 aa, 11 kDa
Observed Molecular Weight 10 KDa
GenBank Accession NumberBC006819
Gene Symbol S100P
Gene ID (NCBI) 6286
RRIDAB_2882712
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP25815
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

S100P protein is a relatively small (95 amino acid) isoform of the S100 protein family that was first isolated from human placenta. Overexpression of S100P has been detected in several cancers such as breast, colon, prostate, pancreatic and lung carcinomas, and the protein has been functionally implicated in carcinogenic processes. S100P protein is widely expressed in both normal and neoplastic tissues. It clearly shows ectopic expression in some cancers. Based on the high expression in certain tumors, S100P could represent a potential target for novel diagnostic and therapeutic applications.

Loading...
||
New chat

Able

正在加载,请稍候...