RIG-1/DDX58 Monoclonal antibody

RIG-1/DDX58 Monoclonal Antibody for WB, IF/ICC, ELISA
Cat No. 67556-1-Ig
Clone No.3B10F5

Host / Isotype

Mouse / IgG1

Reactivity

human and More (1)

Applications

WB, IF/ICC, ELISA

DDX58, RIG-I, 3B10F5, Antiviral innate immune response receptor RIG-I, ATP-dependent RNA helicase DDX58

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA-253 cells, SW 1990 cells, MDA-MB-231 cells, SCaBER cells, HeLa cells
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67556-1-Ig targets RIG-1/DDX58 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, duck
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag18591

Product name: Recombinant human DDX58 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 575-925 aa of BC132786

Sequence: RAAGFDEIEQDLTQRFEEKLQELESVSRDPSNENPKLEDLCFILQEEYHLNPETITILFVKTRALVDALKNWIEGNPKLSFLKPGILTGRGKTNQNTGMTLPAQKCILDAFKASGDHNILIATSVADEGIDIAQCNLVILYEYVGNVIKMIQTRGRGRARGSKCFLLTSNAGVIEKEQINMYKEKMMNDSILRLQTWDEAVFREKILHIQTHEKFIRDSQEKPKPVPDKENKKLLCRKCKALACYTADVRVIEECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGVQTLYSKWKDFHFEKIPFDPAEMSK

Predict reactive species
Full Name DEAD (Asp-Glu-Ala-Asp) box polypeptide 58
Calculated Molecular Weight 925 aa, 106 kDa
Observed Molecular Weight 101/106 kDa
GenBank Accession NumberBC132786
Gene Symbol RIG-1/DDX58
Gene ID (NCBI) 23586
RRIDAB_2882770
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO95786
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DDX58, also named as RIG-1, belongs to the helicase family. It is involved in innate immune defense against viruses. Upon interaction with intracellular dsRNA produced during viral replication, triggers a transduction cascade involving MAVS/IPS1, which results in the activation of NF-kappa-B, IRF3 and IRF7 and the induction of the expression of antiviral cytokines such as IFN-beta and RANTES (CCL5). Detects dsRNA produced from non-self dsDNA by RNA polymerase III, such as Epstein-Barr virus-encoded RNAs (EBERs). It is essential for the production of interferons in response to RNA viruses including paramyxoviruses, influenza viruses, Japanese encephalitis virus and HCV. The antibody is specific to DDX58,which has two isoform with the MW of 106 and 101 kDa.

Protocols

Product Specific Protocols
WB protocol for RIG-1/DDX58 antibody 67556-1-IgDownload protocol
IF protocol for RIG-1/DDX58 antibody 67556-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Autophagy

N protein of PEDV plays chess game with host proteins by selective autophagy

Authors - Xueying Zhai

J Virol

RBM14 inhibits the replication of porcine epidemic diarrhea virus by recruiting p62 to degrade nucleocapsid protein through the activation of autophagy and interferon pathway

Authors - Xiaoquan Wang
humanWB

Nat Commun

TRIM25 predominately associates with anti-viral stress granules

Authors - Zehua Shang
humanWB

Redox Biol

Nlrp6 protects from corticosterone-induced NSPC ferroptosis by modulating RIG-1/MAVS-mediated mitophagy

Authors - Jingyan Shen
duckWB

Poult Sci

Matrine relieved DHAV-1-induced hepatocyte excessive interferon and pyroptosis by activating mitophagy

Authors - Weiran Wang

Vet Microbiol

BTG3 inhibits porcine epidemic diarrhea virus replication by promoting viral S2 protein degradation through the autophagy and proteasome pathways

Authors - Qingxiao Zhu
Loading...
||
New chat Able
正在加载,请稍候...