CEP290 Monoclonal antibody, PBS Only (Detector)

CEP290 Monoclonal Antibody for Indirect ELISA, Cytometric bead array
Cat No. 67716-3-PBS
Clone No.2H4G5

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

Indirect ELISA, Cytometric bead array

3H11Ag, BBS14, Cancer/testis antigen 87, centrosomal protein 290kDa, Centrosomal protein of 290 kDa, CEP290, CT87, FLJ13615, FLJ21979, JBTS5, JBTS6, KIAA0373, LCA10, MKS4, Nephrocystin 6, rd16, SLSN6, Tumor antigen se2 2

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67716-3-PBS targets CEP290 as part of a matched antibody pair:

MP50156-1: 67716-2-PBS capture and 67716-3-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity Human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17457

Product name: Recombinant human CEP290 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-237 aa of BC008641

Sequence: QMDSDEMKKILAENSRKITVLQVNEKSLIRQYTTLVELERQLRKENEKQKNELLSMEAEVCEKIGCLQRFKEMAIFKIAALQKVVDNSVSLSELELANKQYNELTAKYRDILQKDNMLVQRTSNLEHLECENISLKEQVESINKELEITKEKLHTIEQAWEQETKLGNESSMDKAKKSITNSDIVSISKKITMLEMKELNERQRAEHCQKMYEHLRTSLKQMEERNFELETKFAEV

Predict reactive species
Full Name centrosomal protein 290kDa
Calculated Molecular Weight 2479 aa, 290 kDa
GenBank Accession NumberBC008641
Gene Symbol CEP290
Gene ID (NCBI) 80184
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO15078
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...