Home
Products
Primary Antibodies
CNOT4 Monoclonal antibody, PBS Only (Capture) (67798-1-PBS)

CNOT4 Monoclonal antibody, PBS Only (Capture)

Name: CNOT4 Monoclonal antibody, PBS Only (Capture), 100ug
Brand: Proteintech
SKU: 67798-1-PBS-100UG

CNOT4 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, Cytometric bead array, Indirect ELISA

Cat No. 67798-1-PBS

Clone No. 4H5H3

Review Product

Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, Cytometric bead array, Indirect ELISA

Synonyms

4H5H3, CCR4 associated factor 4, CCR4-associated factor 4, CCR4-NOT transcription complex subunit 4, CLONE243

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF-PIF/ICCCytometric bead array sample testCytometric bead array

WB analysis using 67798-1-Ig (same clone as 67798-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 67798-1-Ig (CNOT4 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control. This data was developed using the same antibody clone with 67798-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
Various lysates were subjected to SDS PAGE followed by western blot with 67798-1-Ig (CNOT4 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control. This data was developed using the same antibody clone with 67798-1-PBS in a different storage buffer formulation.
WB analysis of MCF-7 using 67798-1-Ig (same clone as 67798-1-PBS)
WB result of CNOT4 antibody (67798-1-Ig; 1:40000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CNOT4 transfected MCF-7 cells. This data was developed using the same antibody clone with 67798-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of U2OS using 67798-1-Ig (same clone as 67798-1-PBS)
U2OS cells were subjected to SDS PAGE followed by western blot with 67798-1-Ig (CNOT4 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67798-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 67798-1-Ig (same clone as 67798-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67798-1-Ig (CNOT4 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67798-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 67798-1-Ig (same clone as 67798-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67798-1-Ig (CNOT4 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67798-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of human colon cancer using 67798-1-Ig (same clone as 67798-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed human colon cancer tissue using CNOT4 antibody (67798-1-Ig, Clone: 4H5H3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67798-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of human colon cancer using 67798-1-Ig (same clone as 67798-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed human colon cancer tissue using CNOT4 antibody (67798-1-Ig, Clone: 4H5H3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67798-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HepG2 using 67798-1-Ig (same clone as 67798-1-PBS)
Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CNOT4 antibody (67798-1-Ig, Clone: 4H5H3 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67798-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Cytometric bead array sample test of MP51911-1
Cytometric bead array sample test of MP51911-1, CNOT4 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67798-1-PBS. Detection antibody: 67798-3-PBS.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Cytometric bead array sample test of MP51911-2
Cytometric bead array sample test of MP51911-2, CNOT4 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67798-1-PBS. Detection antibody: 67798-2-PBS.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Cytometric bead array standard curve of MP51911-1
Cytometric bead array standard curve of MP51911-1, CNOT4 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67798-1-PBS. Detection antibody: 67798-3-PBS. Standard:Ag29964. Range: 0.078-10 ng/mL.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Cytometric bead array standard curve of MP51911-2
Cytometric bead array standard curve of MP51911-2, CNOT4 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67798-1-PBS. Detection antibody: 67798-2-PBS. Standard:Ag29964. Range: 0.078-10 ng/mL.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CNOT4 in ?

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

67798-1-PBS targets CNOT4 as part of a matched antibody pair:

MP51911-1: 67798-1-PBS capture and 67798-3-PBS detection (validated in Cytometric bead array)

MP51911-2: 67798-1-PBS capture and 67798-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity	human, mouse, rat
Host / Isotype	Mouse / IgG2b
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag29964 Product name: Recombinant human CNOT4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 273-572 aa of BC035590 Sequence: IDKPSDSLSIGNGDNSQQISNSDTPSPPPGLSKSNPVIPISSSNHSARSPFEGAVTESQSLFSDIFRHPNPIPSGLPPFPSSPQTSSDWPTAPEPQSLFTSETIPVSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKELSVQDQPSLSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRFPQFQQHRAVYNSFSFPGQAARYPWMAFPRNSIMHLNHTANPTSNSNFLDLNLPPQHNTGLGGIPVAGEEEVKVSTMPLSTSSHSLQQGQQPTSLHTTVA Predict reactive species
Full Name	CCR4-NOT transcription complex, subunit 4
Calculated Molecular Weight	575 aa, 64 kDa
Observed Molecular Weight	64-85 kDa
GenBank Accession Number	BC035590
Gene Symbol	CNOT4
Gene ID (NCBI)	4850
RRID	AB_2918562
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	O95628
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

CNOT4, also known as CCR4-NOT transcription complex subunit 4 , has E3 ubiquitin ligase activity, and promotes ubiquitination and degradation of target proteins. CNOT4 is involved in activation of the JAK/STAT pathway. CNOT4 exist many isoforms and the range of its molecular weight from 48 to 84 kDa.