• Featured Product
  • KD/KO Validated

NMT1 Monoclonal antibody

NMT1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 67984-1-Ig
Clone No.2D9B9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

2D9B9, EC:2.3.1.-, EC:2.3.1.97, Glycylpeptide N-tetradecanoyltransferase 1, HsNMT1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, HeLa cells, L02 cells, PC-3 cells, SKOV-3 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells
Positive IHC detected inhuman breast cancer tissue, human liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 1 publications below

Product Information

67984-1-Ig targets NMT1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag20541

Product name: Recombinant human NMT1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-301 aa of BC006569

Sequence: MADESETAVKPPAPPLPQMMEGNGNGHEHCSDCENEEDNSYNRGGLSPANDTGAKKKKKKQKKKKEKGSETDSAQDQPVKMNSLPAERIQEIQKAIELFSVGQGPAKTMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFTWDALDLGDRGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLPQWHCGVRVVSSRKLVGFISAIPANIHIYDTEKKMVEINFLCVHKKLRSKRVAPVLIREITRRVHLEGIFQAVYTAGVVLPKPVGTCRYWHRSL

Predict reactive species
Full Name N-myristoyltransferase 1
Calculated Molecular Weight 496 aa, 57 kDa
Observed Molecular Weight50-60 kDa
GenBank Accession NumberBC006569
Gene Symbol NMT1
Gene ID (NCBI) 4836
RRIDAB_2918733
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP30419
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NMT1 is a N-myristoyltransferase responsible for the transfer of myristate from CoA to an amino-terminal glycine of many eukaryotic proteins, which facilitates the targeting of proteins to membrane surfaces and is essential for viability of the organism. Insertional mutagenesis of the Nmt1 gene in Saccharomyces cerevisiae causes recessive lethality. Humans and mice possess two distinct but structurally similar enzymes, NMT1 and NMT2, ubiquitously expressed in most human and mouse tissues. Western analysis revealed that there are 4 isoforms of NMT1 with apparent molecular masses ranging from 49 to 68 kDa. In cell fractionation studies, the 68-kDa NMT1 isoform and NMT2 were present in both membrane and cytoplasmic fractions, while the smaller NMT1 isoforms were predominantly cytoplasmic.

Protocols

Product Specific Protocols
IF protocol for NMT1 antibody 67984-1-IgDownload protocol
IHC protocol for NMT1 antibody 67984-1-IgDownload protocol
WB protocol for NMT1 antibody 67984-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

J Cell Sci

HIV-1 N-myristoylation-dependent hijacking of late endosomes/lysosomes to drive Gag assembly in macrophages

Authors - Gabriel I Guajardo-Contreras
Loading...
||
New chat Able
正在加载,请稍候...