FATP2 Monoclonal antibody, PBS Only (Capture)

FATP2 Monoclonal Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 68074-1-PBS
Clone No.2C10D7

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA

SLC27A2, EC:6.2.1.24, EC:6.2.1.15, EC:6.2.1.-, Arachidonate--CoA ligase

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68074-1-PBS targets FATP2 as part of a matched antibody pair:

MP50832-1: 68074-1-PBS capture and 68074-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag5390

Product name: Recombinant human SLC27A2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 208-567 aa of BC057770

Sequence: ESWRSEVTFSTPALYIYTSGTTGATLALRTKFSASQFWDDCRKYNVTVIQYIGELLRYLCNSPQKPNDRDHKVRLALGNGLRGDVWRQFVKRFGDICIYEFYAATEGNIGFMNYARKVGAVGRVNYLQKKIITYDLIKYDVEKDEPVRDENGYCVRVPKGEVGLLVCKITQLTPFNGYAGAKAQTEKKKLRDVFKKGDLYFNSGDLLMVDHENFIYFHDRVGDTFRWKGENVATTEVADTVGLVDFVQEVNVYGVHVPDHEGRIGMASIKMKENHEFDGKKLFQHIADYLPSYARPRFLRIQDTIEITGTFKHRKMTLVEEGFNPAVIKDALYFLDDTAKMYVPMTEDIYNAISAKTLKL

Predict reactive species
Full Name solute carrier family 27 (fatty acid transporter), member 2
Calculated Molecular Weight 567 aa, 65 kDa
Observed Molecular Weight 70 kDa
GenBank Accession NumberBC057770
Gene Symbol FATP2/SLC27A2
Gene ID (NCBI) 11001
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO14975
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

FATP2 is a member of the FATP family which functions in lipid and bile metabolism. It is a 70-kDa protein predominantly expressed in liver and kidney. Kidney FATP2 is localized exclusively to proximal tubule epithelial cells along the apical but not the basolateral membrane, and regulates lipoapoptosis. FATP2 is involved in metabolism-related diseases including nonalcoholic fatty liver disease (NAFLD) and type 2 diabetes mellitus (T2DM), and is a potential clinical biomarker and therapeutic target.

Loading...
||
New chat Able
正在加载,请稍候...