EIF3B Monoclonal antibody

EIF3B Monoclonal Antibody for WB, ELISA
Cat No. 68202-1-Ig
Clone No.1G12G12

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat and More (1)

Applications

WB, ELISA

eIF 3 eta, EIF3 ETA, EIF3 P110, EIF3 P116, EIF3B, EIF3S9, hPrt1, PRT1, Prt1 homolog

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHCT 116 cells, A431 cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

68202-1-Ig targets EIF3B in WB, ELISA applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag31427

Product name: Recombinant human EIF3B protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 381-562 aa of BC001173

Sequence: FSPCERYLVTFSPLMDTQDDPQAIIIWDILTGHKKRGFHCESSAHWPIFKWSHDGKFFARMTLDTLSIYETPSMGLLDKKSLKISGIKDFSWSPGGNIIAFWVPEDKDIPARVTLMQLPTRQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTPKGTQGVVTNFEIFRMREKQVPVDVVEMK

Predict reactive species
Full Name eukaryotic translation initiation factor 3, subunit B
Calculated Molecular Weight 93 kDa
Observed Molecular Weight 115 kDa
GenBank Accession NumberBC001173
Gene Symbol EIF3B
Gene ID (NCBI) 8662
RRIDAB_2935290
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP55884
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EIF3B, also named Eukaryotic translation initiation factor 3 subunit B, is an 814 amino acid protein, which contains 1 RRM (RNA recognition motif) domain and 8 WD repeats and belongs to the eIF-3 subunit B family. EIF3B as an RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation, and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression. The calculated molecular weight of EIF3B is 93 kDa, but the phosphorylated EIF3B protein is about 115 kDa.

Protocols

Product Specific Protocols
WB protocol for EIF3B antibody 68202-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Mol Cancer

The miR-23a/27a/24 - 2 cluster drives immune evasion and resistance to PD-1/PD-L1 blockade in non-small cell lung cancer

Authors - Hao Luo
  • KD Validated
Loading...
||
New chat

Able

正在加载,请稍候...