Smac/DIABLO Monoclonal antibody, PBS Only (Detector)

Smac/DIABLO Monoclonal Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 68480-1-PBS
Clone No.2F12C9

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

DIABLO, 2F12C9, DFNA64, Diablo homolog, mitochondrial, Diablo IAP-binding mitochondrial protein

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68480-1-PBS targets Smac/DIABLO as part of a matched antibody pair:

MP50334-2: 68480-4-PBS capture and 68480-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag32774

Product name: Recombinant human DIABLO protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-239 aa of BC011909

Sequence: MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED

Predict reactive species
Full Name diablo homolog (Drosophila)
Calculated Molecular Weight 27 kDa
Observed Molecular Weight 20 kDa
GenBank Accession NumberBC011909
Gene Symbol DIABLO
Gene ID (NCBI) 56616
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NR28
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Smac/DIABLO is a mitochondrial protein that promotes apoptosis by neutralizing members of the IAP family. SMAC/DIABLO is ubiquitously expressed in normal tissues, and the expression of SMAC messenger RNA (mRNA) in adult testis is the highest .Smac/DIABLO encodes a 239 amino acid protein (~27 kDa). The first 55 amino acids are a mitochondrial targeting signal peptide that is cleaved to generate mature Smac-DIABLO (~21 kDa). When released from mitochondria, Smac-DIABLO acts as a natural antagonist of inhibitor of apoptosis proteins (IAPs). Smac-DIABLO antagonistic activity is based on its N-terminal tetrapeptide (AVPI) that binds baculoviral IAP repeat (BIR) domains of IAPs, releasing their inhibitory effects on both initiator and effector caspases, thus promoting cell death. (PMID: 32325691, PMID: 32575872,PMID: 25650938)

Loading...
||
New chat Able
正在加载,请稍候...