TEX264 Monoclonal antibody, PBS Only (Capture)

TEX264 Monoclonal Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 68507-1-PBS
Clone No.2D12G1

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

UNQ337/PRO536, TEX 264, Testis-expressed protein 264, TEG 264, SIG11

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68507-1-PBS targets TEX264 as part of a matched antibody pair:

MP50870-1: 68507-1-PBS capture and 68507-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag33710

Product name: Recombinant human TEX264 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 34-313 aa of BC008742

Sequence: VEVSAGSPPIRNVTVAYKFHMGLYGETGRLFTESCSISPKLRSIAVYYDNPHMVPPDKCRCAVGSILSEGEESPSPELIDLYQKFGFKVFSFPAPSHVVTATFPYTTILSIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPLARQGDFYVPEMKETEWKWRGLVEAIDTQVDGTGADTMSDTSSVSLEVSPGSRETSAATLSPGASSRGWDDGDTRSEHSYSESGASGSSFEELDLEGEGPLGESRLDPGTEPLGTTKWLWEPTAPEKGKE

Predict reactive species
Full Name testis expressed 264
Calculated Molecular Weight 313 aa, 34 kDa
Observed Molecular Weight37 kDa
GenBank Accession NumberBC008742
Gene Symbol TEX264
Gene ID (NCBI) 51368
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9Y6I9
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TEX264 (testes expressed gene 264) is a single-pass transmembrane protein, consisting of an N-terminal hydrophobic region, a gyrase inhibitory (GyrI)-like domain, and a loosely structured C terminus. TEX264 was first identified as an endoplasmic reticulum (ER)-resident Atg8-family-binding protein that mediates the degradation of portions of the ER during starvation (i.e., reticulophagy). TEX264 was identified as a cofactor of VCP/p97 ATPase that promotes the repair of covalently trapped TOP1 (DNA topoisomerase 1)-DNA crosslinks.

Loading...
||
New chat Able
正在加载,请稍候...