CEACAM8 Monoclonal antibody, PBS Only (Capture)

CEACAM8 Monoclonal Antibody for Sandwich ELISA, Indirect ELISA
Cat No. 68683-1-PBS
Clone No.2B4F1

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA

CD66b, Carcinoembryonic antigen CGM6, Carcinoembryonic antigen-related cell adhesion molecule 8, CD 66b, CD 67

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68683-1-PBS targets CEACAM8 as part of a matched antibody pair:

MP50039-1: 68683-1-PBS capture and 68683-2-PBS detection (validated in Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Eg32133

Product name: Recombinant Human CEACAM-8 protein (Myc Tag, His Tag)

Source: mammalian cells-derived, pHZ-KIsec

Tag: Myc & 6*His

Domain: 35-319 aa of BC026263

Sequence: QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVS

Predict reactive species
Full Name carcinoembryonic antigen-related cell adhesion molecule 8
Calculated Molecular Weight 38 kDa
GenBank Accession NumberBC026263
Gene Symbol CEACAM8
Gene ID (NCBI) 1088
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP31997
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Carcinoembryonic antigen-related cell adhesion molecule 8 (CEACAM8), also known as CD66b, CGM6 or NCA-95, is a member of the cacinoembryonic antigen (CEA) family which belongs to the immunoglobulin superfamily of cell adhesion molecules (PMID: 16919437). CEACAM8 is a glycosylphosphatidylinositol (GPI)-linked glycoprotein expressed on granulocytes (PMID: 8104998; 18056392). It is involved in regulating adhesion and activation of eosinophils (PMID: 18056392).

Loading...
||
New chat Able
正在加载,请稍候...