S100A14 Monoclonal antibody, PBS Only (Capture)

S100A14 Monoclonal Antibody for Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 68690-1-PBS
Clone No.1D12A2

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

Sandwich ELISA, Indirect ELISA, Sample test

Protein S100 A14, Protein S100-A14, S100 calcium-binding protein A14, S100A15, S114

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68690-1-PBS targets S100A14 as part of a matched antibody pair:

MP50082-1: 68690-1-PBS capture and 68690-2-PBS detection (validated in Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag29970

Product name: Recombinant human S100A14 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-104 aa of BC005019

Sequence: MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH

Predict reactive species
Full Name S100 calcium binding protein A14
Calculated Molecular Weight 12 kDa
GenBank Accession NumberBC005019
Gene Symbol S100A14
Gene ID (NCBI) 57402
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9HCY8
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.
Loading...
||
New chat Able
正在加载,请稍候...